Germany
Japan
United Kingdom
China
Neuropeptide Y (NPY) (68-97) rabbit polyclonal antibody, Serum
| Applications | IF, IHC |
| Reactivities | Human, Rat |
| Immunogen | Synthetic Prepro-NPY 68-97 (C-PON). |
Products
View as table DownloadRabbit Polyclonal Anti-NPY Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-NPY antibody is: synthetic peptide directed towards the middle region of Human NPY. Synthetic peptide located within the following region: CLGALAEAYPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRYGKRSSP |
Rabbit polyclonal anti Neuropeptide Y (bo, po); neat antiserum
| Applications | ELISA |
| Reactivities | Bovine, Porcine |
| Conjugation | Unconjugated |
Neuropeptide Y (NPY) rabbit polyclonal antibody, Serum
| Applications | IF, IHC |
| Reactivities | Human, Rat |
| Immunogen | Synthetic peptide corresponding to the C-flanking peptide (amino acids 68-97) of Neuropeptide Y. |
Neuropeptide Y (NPY) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
Neuropeptide Y, rabbit anti human/mouse/rat, polyclonal.
| Applications | ELISA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala- Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn- Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2 |
Neuropeptide Y (NPY), rabbit anti human/mouse/rat, polyclonal.
| Applications | ELISA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala- Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn- Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2 coupled to carrier protein. |
Neuropeptide Y (NPY), rabbit anti human/mouse/rat/porcine, polyclonal, diluted Antiserum for RIA.
| Applications | ELISA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala- Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn- Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2 coupled to carrier protein. |
Rabbit polyclonal anti Neuropeptide Y (bo, po); diluted antiserum
| Applications | ELISA |
| Reactivities | Bovine, Porcine |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala- Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn- Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2 coupled to carrier protein. |
Rabbit polyclonal anti Neuropeptide Y (bo, po); purified rabbit IgG
| Applications | ELISA |
| Reactivities | Bovine, Porcine |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala- Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn- Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2 coupled to carrier protein. |
Anti-NPY Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Active filters
Target Symbol
- NPY
Antibody Hosts
- Rabbit