Products

cDNA Clones (26)
Antibodies (22)
RNAi (12)
Proteins (8)
Gene Expression (6)
Assay Kits (2)
Jump to Filters
View as table Download
Npy (NM_023456) Mouse Tagged ORF Clone
MR226370

USD 68.00

USD 390.00

In Stock

Npy (Myc-DDK-tagged) - Mouse neuropeptide Y (Npy)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Neuropeptide Y (NPY) (NM_000905) Human Tagged ORF Clone
RC206056

USD 98.00

USD 390.00

In Stock

NPY (Myc-DDK-tagged)-Human neuropeptide Y (NPY)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Npy (NM_023456) Mouse Tagged ORF Clone
MG226370

USD 300.00

In Stock

Npy (GFP-tagged) - Mouse neuropeptide Y (Npy), (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Neuropeptide Y (NPY) (NM_000905) Human Tagged ORF Clone
RG206056

USD 460.00

In Stock

NPY (GFP-tagged) - Human neuropeptide Y (NPY)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Npy Mouse Gene Knockout Kit (CRISPR)
KN511183

USD 1,290.00

2 Weeks

Npy - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN511183 is the updated version of KN311183.
Npy (NM_023456) Mouse Tagged ORF Clone
MR226370L3

USD 500.00

3 Weeks

Lenti ORF clone of Npy (Myc-DDK-tagged) - Mouse neuropeptide Y (Npy)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Npy (NM_023456) Mouse Tagged ORF Clone
MR226370L4

USD 500.00

3 Weeks

Lenti ORF clone of Npy (mGFP-tagged) - Mouse neuropeptide Y (Npy)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Npy (NM_012614) Rat Tagged ORF Clone
RR214992

USD 420.00

3 Weeks

Npy (Myc-DDK-tagged ORF) - Rat neuropeptide Y (Npy), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Npy (NM_012614) Rat Tagged ORF Clone
RR214992L3

USD 640.00

7 Weeks

Lenti ORF clone of Npy (Myc-DDK-tagged ORF) - Rat neuropeptide Y (Npy), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Npy (NM_012614) Rat Tagged ORF Clone
RR214992L4

USD 700.00

7 Weeks

Lenti ORF clone of Npy (mGFP-tagged ORF) - Rat neuropeptide Y (Npy), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Npy (NM_012614) Rat Tagged ORF Clone Lentiviral Particle
RR214992L4V

USD 960.00

11 Weeks

Lenti ORF particles, Npy (GFP-tagged ORF) - Rat neuropeptide Y (Npy), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Neuropeptide Y (NPY) (68-97) Rabbit Polyclonal Antibody
AP09564SU-N

USD 600.00

2 Weeks

Neuropeptide Y (NPY) (68-97) rabbit polyclonal antibody, Serum

Applications IF, IHC
Reactivities Human, Rat
Immunogen Synthetic Prepro-NPY 68-97 (C-PON).
Neuropeptide Y (NPY) (NM_000905) Human Untagged Clone
SC119601

USD 310.00

In Stock

NPY (untagged)-Human neuropeptide Y (NPY)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Npy (NM_023456) Mouse Untagged Clone
MC212210

USD 420.00

In Stock

Npy (untagged) - Mouse neuropeptide Y (Npy), (10ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Neuropeptide Y (NPY) Rabbit Polyclonal Antibody
TA346234

USD 475.00

5 Days

Rabbit Polyclonal Anti-NPY Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-NPY antibody is: synthetic peptide directed towards the middle region of Human NPY. Synthetic peptide located within the following region: CLGALAEAYPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRYGKRSSP
Neuropeptide Y (NPY) (NM_000905) Human Recombinant Protein
TP761100

USD 215.00

In Stock

Purified recombinant protein of Human neuropeptide Y (NPY), full length, with N-terminal HIS tag, expressed in E. coli, 50ug

Tag N-His
Expression Host E. coli
Neuropeptide Y (NPY) (31-36) Rabbit Polyclonal Antibody
AP22875PU-N

USD 440.00

2 Weeks

Neuropeptide Y (NPY) (31-36) rabbit polyclonal antibody, Purified

Applications ELISA, IF, IHC
Reactivities Porcine
Immunogen Synthetic Porcine Neuropeptide Y coupled to bovine thyroglobulin via glutaraldehyde
Neuropeptide Y (NPY) (NM_000905) Human Tagged ORF Clone
RC206056L1

USD 620.00

In Stock

Lenti ORF clone of Human neuropeptide Y (NPY), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
Neuropeptide Y (NPY) (NM_000905) Human Tagged ORF Clone
RC206056L2

USD 620.00

3 Weeks

Lenti ORF clone of Human neuropeptide Y (NPY), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
NPY Rabbit Polyclonal Antibody
TA364161

USD 400.00

2 Weeks

Rabbit polyclonal anti Neuropeptide Y (bo, po); neat antiserum

Applications ELISA
Reactivities Bovine, Porcine
Conjugation Unconjugated
Neuropeptide Y (NPY) Rabbit Polyclonal Antibody
BP162

USD 340.00

5 Days

Neuropeptide Y (NPY) rabbit polyclonal antibody, Serum

Applications IF, IHC
Reactivities Human, Rat
Immunogen Synthetic peptide corresponding to the C-flanking peptide (amino acids 68-97) of Neuropeptide Y.
Neuropeptide Y (NPY) Rabbit Polyclonal Antibody
RA24603-100

USD 360.00

2 Weeks

Neuropeptide Y (NPY) rabbit polyclonal antibody

Applications IF, IHC
Reactivities Chicken, Feline, Guinea Pig, Human, Rat, Zebrafish
Conjugation Unconjugated
Neuropeptide Y (NPY) Rabbit Polyclonal Antibody
AP20664PU-N

USD 370.00

2 Weeks

Neuropeptide Y (NPY) rabbit polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Human, Mouse, Rat
Neuropeptide Y (NPY) Guinea Pig Polyclonal Antibody
GP14107-150

USD 440.00

2 Weeks

Neuropeptide Y (NPY) guinea pig polyclonal antibody

Applications IHC
Reactivities Rat
Conjugation Unconjugated
Neuropeptide Y (NPY) Human qPCR Primer Pair (NM_000905)
HP200843

USD 120.00

5 Days

qSTAR qPCR primer pairs against Homo sapiens gene NPY

Component 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions)
Neuropeptide Y (NPY) Rabbit Polyclonal Antibody
TA363924

USD 415.00

2 Weeks

Neuropeptide Y, rabbit anti human/mouse/rat, polyclonal.

Applications ELISA
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide H-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala- Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn- Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2
Neuropeptide Y (NPY) Rabbit Polyclonal Antibody
TA363925

USD 710.00

2 Weeks

Neuropeptide Y (NPY), rabbit anti human/mouse/rat, polyclonal.

Applications ELISA
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide H-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala- Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn- Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2 coupled to carrier protein.
Neuropeptide Y (NPY) Rabbit Polyclonal Antibody
TA363928

USD 690.00

2 Weeks

Neuropeptide Y (NPY), rabbit anti human/mouse/rat/porcine, polyclonal, diluted Antiserum for RIA.

Applications ELISA
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide H-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala- Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn- Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2 coupled to carrier protein.
NPY Rabbit Polyclonal Antibody
TA364162

USD 690.00

2 Weeks

Rabbit polyclonal anti Neuropeptide Y (bo, po); diluted antiserum

Applications ELISA
Reactivities Bovine, Porcine
Conjugation Unconjugated
Immunogen Synthetic peptide H-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala- Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn- Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2 coupled to carrier protein.
NPY Rabbit Polyclonal Antibody
TA364165

USD 655.00

2 Weeks

Rabbit polyclonal anti Neuropeptide Y (bo, po); purified rabbit IgG

Applications ELISA
Reactivities Bovine, Porcine
Conjugation Unconjugated
Immunogen Synthetic peptide H-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala- Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn- Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2 coupled to carrier protein.
Neuropeptide Y / NPY Human Protein
AR05070PU-N

USD 270.00

5 Days

Neuropeptide Y / NPY human protein, 0.1 mg

Neuropeptide Y / NPY Human, Rat Protein
AR31131PU-L

USD 540.00

5 Days

Neuropeptide Y / NPY human, rat protein, 1.0 mg

Neuropeptide Y / NPY Human, Rat Protein
AR31131PU-N

USD 365.00

5 Days

Neuropeptide Y / NPY human, rat protein, 0.5 mg

Neuropeptide Y (NPY) Mouse Monoclonal Antibody [Clone ID: OTI8F8]
CF808282

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) NPY mouse monoclonal antibody, clone OTI8F8 (formerly 8F8)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Human Neuropeptide Y (NPY) activation kit by CRISPRa
GA103239

USD 1,290.00

2 Weeks

NPY CRISPRa kit - CRISPR gene activation of human neuropeptide Y

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Mouse Npy activation kit by CRISPRa
GA212238

USD 1,290.00

2 Weeks

Npy CRISPRa kit - CRISPR gene activation of mouse neuropeptide Y

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Neuropeptide Y (NPY) Human qPCR Template Standard (NM_000905)
HK205190

USD 330.00

5 Days

qPCR primer pairs and template standards against Homo sapiens gene NPY

Application Plasmid of exact quantity for transcript copy number calculation
Npy Mouse qPCR Primer Pair (NM_023456)
MP208850

USD 120.00

5 Days

qSTAR qPCR primer pairs against Mus musculus gene Npy