Products

View as table Download

Rabbit polyclonal antibody to Progesterone receptor (progesterone receptor)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 18 and 112 of Progesterone Receptor (Uniprot ID#P06401)

Rabbit Polyclonal Progesterone Receptor Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Progesterone Receptor

Rabbit Polyclonal Progesterone Receptor (Ser294) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Progesterone Receptor around the phosphorylation site of Serine 294
Modifications Phospho-specific

Rabbit Polyclonal Progesterone Receptor (Ser400) Antibody (Phospho-specific)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Progesterone Receptor around the phosphorylation site of Serine 400
Modifications Phospho-specific

Rabbit Polyclonal Progesterone Receptor Antibody

Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Progesterone Receptor

Progesterone Receptor (PGR) (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 348-377 amino acids from the Central region of human Progesterone receptor

Rabbit polyclonal PGR/PR Antibody (C-term)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This PGR/PR antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 816-843 amino acids from the C-terminal region of human PGR/PR.

Rabbit anti Progesterone Receptor (PR) Polyclonal Antibody

Applications IHC, WB
Reactivities Bovine, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to C-terminus of human Progesterone receptor. This sequence is identical within human, mouse, rat, chicken, bovine and dog origins.

Rabbit Polyclonal anti-PR Antibody

Applications WB
Reactivities Human
Immunogen The immunogen for Anti-PR antibody is: synthetic peptide directed towards the N-terminal region of Human PR. Synthetic peptide located within the following region: LPRGLSPARQLLLPASESPHWSGAPVKPSPQAAAVEVEEEDGSESEESAG

Pgr Antibody - middle region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of mouse Pgr

Progesterone Receptor Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human Progesterone Receptor (NP_000917.3).
Modifications Unmodified

Progesterone Receptor Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 830 to the C-terminus of human Progesterone Receptor (NP_000917.3).
Modifications Unmodified