Products

Jump to Filters
View as table Download
CHSY1 Rabbit Polyclonal Antibody
TA315190

USD 345.00

4 Weeks

Rabbit polyclonal anti-CHSY1 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CHSY1.
CHSY3 Rabbit Polyclonal Antibody
AP01393PU-N

USD 370.00

2 Weeks

CHSY3 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide, corresponding to amino acids 640-690 of Human CHSY2.
CHPF Rabbit Polyclonal Antibody
TA315791

USD 345.00

In Stock

Rabbit polyclonal anti-CHPH (CHSS2) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CHSS2.
CHST13 Rabbit Polyclonal Antibody
TA316196

USD 345.00

In Stock

Rabbit polyclonal anti-CHST13 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CHST13.
CHPF (Center) Rabbit Polyclonal Antibody
AP50902PU-N

USD 450.00

2 Weeks

CHPF (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human, Mouse
Immunogen Synthetic peptide - KLH conjugated - corresponding to the center region of human Chondroitin sulfate synthase 2/CHPF.
CSGALNACT2 Rabbit Polyclonal Antibody
TA315587

USD 345.00

In Stock

Rabbit polyclonal CSGALNACT2 antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CSGALNACT2.
CSGALNACT1 Rabbit Polyclonal Antibody
TA315606

USD 345.00

In Stock

Rabbit polyclonal CSGALNACT1 antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CSGALNACT1.
CD57 (B3GAT1) Rabbit Polyclonal Antibody
TA351058

USD 345.00

4 Weeks

Rabbit Polyclonal Anti-B3GAT1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human B3GAT1
CHST3 (N-term) Rabbit Polyclonal Antibody
AP50912PU-N

USD 450.00

2 Weeks

CHST3 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen Synthetic peptide - KLH conjugated - corresponding to the N-terminal region (between 32-62aa) of human CHST3.
CD57 (B3GAT1) Rabbit Polyclonal Antibody
TA309582

USD 424.00

5 Days

Rabbit Polyclonal CD57 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to a C-terminal portion of the human CD57 protein (between residues 250-300) [UniProt Q9P2W7]
CD57 (B3GAT1) Rabbit Polyclonal Antibody
TA336743

USD 424.00

5 Days

Rabbit Polyclonal beta-1,3-Glucuronyltransferase 1/B3GAT1/CD57 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an N-terminal portion of the human CD57 protein (between residues 1-50) [UniProt Q9P2W7]
uronyl 2 sulfotransferase (UST) Rabbit Polyclonal Antibody
TA339020

USD 310.00

5 Days

Rabbit Polyclonal Anti-UST Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UST antibody: synthetic peptide directed towards the C terminal of human UST. Synthetic peptide located within the following region: YFKGVLSIYKDPEHRKLGNMTVTVKKTVPSPEAVQILYQRMRYEYEFYHY
CD57 (B3GAT1) Mouse Monoclonal Antibody [Clone ID: NK1]
TA327647

USD 450.00

5 Days

Mouse Monoclonal B3GAT1 (CD57) Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
CSGALNACT2 Rabbit Polyclonal Antibody
TA349623

USD 345.00

In Stock

Rabbit Polyclonal Anti-CSGALNACT2 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CSGALNACT2