Products

Jump to Filters
View as table Download
CHRNA1 Rabbit Polyclonal Antibody
AP23320PU-N

USD 405.00

2 Weeks

CHRNA1 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen A synthetic peptide corresponding to a sequence at the N-terminal of Human CHRNA1, identical to the related Rat and Mouse sequence
CHRNA1 Rabbit Polyclonal Antibody
TA330009

USD 375.00

5 Days

Rabbit Polyclonal Anti-CHRNA1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHRNA1 antibody: synthetic peptide directed towards the C terminal of human CHRNA1. Synthetic peptide located within the following region: STHVMPNWVRKVFIDTIPNIMFFSTMKRPSREKQDKKIFTEDIDISDISG
CHRNA1 Rabbit Polyclonal Antibody
TA350717

USD 345.00

4 Weeks

Rabbit Polyclonal Anti-CHRNA1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CHRNA1
CHRNA1 Rabbit Polyclonal Antibody
TA371138

USD 380.00

4 Weeks

CHRNA1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CHRNA1