Germany
Japan
United Kingdom
China
CHRNA1 (Myc-DDK-tagged)-Human cholinergic receptor, nicotinic, alpha 1 (muscle) (CHRNA1), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
CHRNA1 (Myc-DDK-tagged)-Human cholinergic receptor, nicotinic, alpha 1 (muscle) (CHRNA1), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Chrna1 (Myc-DDK-tagged) - Mouse cholinergic receptor, nicotinic, alpha polypeptide 1 (muscle) (Chrna1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, CHRNA1 (Myc-DDK-tagged)-Human cholinergic receptor, nicotinic, alpha 1 (muscle) (CHRNA1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, CHRNA1 (mGFP-tagged)-Human cholinergic receptor, nicotinic, alpha 1 (muscle) (CHRNA1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Lenti ORF particles, CHRNA1 (Myc-DDK tagged) - Human cholinergic receptor, nicotinic, alpha 1 (muscle) (CHRNA1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, CHRNA1 (mGFP-tagged) - Human cholinergic receptor, nicotinic, alpha 1 (muscle) (CHRNA1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Chrna1 (GFP-tagged) - Mouse cholinergic receptor nicotinic alpha polypeptide 1 (muscle) (Chrna1), (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CHRNA1 (GFP-tagged) - Human cholinergic receptor, nicotinic, alpha 1 (muscle) (CHRNA1), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CHRNA1 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN416321 is the updated version of KN216321.
Chrna1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN503303 is the updated version of KN303303.
Lenti ORF clone of Chrna1 (Myc-DDK-tagged) - Mouse cholinergic receptor, nicotinic, alpha polypeptide 1 (muscle) (Chrna1)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Chrna1 (Myc-DDK-tagged) - Mouse cholinergic receptor, nicotinic, alpha polypeptide 1 (muscle) (Chrna1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Chrna1 (mGFP-tagged) - Mouse cholinergic receptor, nicotinic, alpha polypeptide 1 (muscle) (Chrna1)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Chrna1 (GFP-tagged) - Mouse cholinergic receptor, nicotinic, alpha polypeptide 1 (muscle) (Chrna1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of CHRNA1 (Myc-DDK-tagged)-Human cholinergic receptor, nicotinic, alpha 1 (muscle) (CHRNA1), transcript variant 2
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CHRNA1 (Myc-DDK-tagged)-Human cholinergic receptor, nicotinic, alpha 1 (muscle) (CHRNA1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of CHRNA1 (mGFP-tagged)-Human cholinergic receptor, nicotinic, alpha 1 (muscle) (CHRNA1), transcript variant 2
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CHRNA1 (mGFP-tagged)-Human cholinergic receptor, nicotinic, alpha 1 (muscle) (CHRNA1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, CHRNA1 (Myc-DDK tagged) - Human cholinergic receptor, nicotinic, alpha 1 (muscle) (CHRNA1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human cholinergic receptor, nicotinic, alpha 1 (muscle) (CHRNA1), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CHRNA1 (mGFP-tagged) - Human cholinergic receptor, nicotinic, alpha 1 (muscle) (CHRNA1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
CHRNA1 (GFP-tagged) - Human cholinergic receptor, nicotinic, alpha 1 (muscle) (CHRNA1), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Chrna1 (Myc-DDK-tagged ORF) - Rat cholinergic receptor, nicotinic, alpha 1 (muscle) (Chrna1), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Chrna1 (Myc-DDK-tagged ORF) - Rat cholinergic receptor, nicotinic, alpha 1 (muscle) (Chrna1), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Chrna1 (Myc-DDK-tagged ORF) - Rat cholinergic receptor, nicotinic, alpha 1 (muscle) (Chrna1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Chrna1 (mGFP-tagged ORF) - Rat cholinergic receptor, nicotinic, alpha 1 (muscle) (Chrna1), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Chrna1 (GFP-tagged ORF) - Rat cholinergic receptor, nicotinic, alpha 1 (muscle) (Chrna1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of CHRNA1 (Myc-DDK-tagged)-Human cholinergic receptor, nicotinic, alpha 1 (muscle) (CHRNA1), transcript variant 2
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
CHRNA1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Lenti ORF clone of Human cholinergic receptor, nicotinic, alpha 1 (muscle) (CHRNA1), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human cholinergic receptor, nicotinic, alpha 1 (muscle) (CHRNA1), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
CHRNA1 (untagged)-Human cholinergic receptor, nicotinic, alpha 1 (muscle) (CHRNA1), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit anti-CHRNA1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CHRNA1 |
Lenti-ORF clone of CHRNA1 (mGFP-tagged)-Human cholinergic receptor, nicotinic, alpha 1 (muscle) (CHRNA1), transcript variant 2
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human cholinergic receptor, nicotinic, alpha 1 (muscle) (CHRNA1), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Transient overexpression lysate of cholinergic receptor, nicotinic, alpha 1 (muscle) (CHRNA1), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Rabbit Polyclonal Anti-Nicotinic Acetylcholine Receptor alpha1 (extracellular)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide EHETRLVAKLFKD(C), corresponding to amino acid residues 22-34 of rat nAChRa1. Extracellular, N-terminus. |
Rabbit Polyclonal Anti-CHRNA1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CHRNA1 antibody: synthetic peptide directed towards the C terminal of human CHRNA1. Synthetic peptide located within the following region: STHVMPNWVRKVFIDTIPNIMFFSTMKRPSREKQDKKIFTEDIDISDISG |
Transient overexpression lysate of cholinergic receptor, nicotinic, alpha 1 (muscle) (CHRNA1), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
CHRNA1 (untagged)-Human cholinergic receptor, nicotinic, alpha 1 (muscle) (CHRNA1), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
SC310367 is the updated version of SC122073.
Rabbit Polyclonal Anti-CHRNA1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CHRNA1 antibody: synthetic peptide directed towards the N terminal of human CHRNA1. Synthetic peptide located within the following region: TRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQLINVDEVNQIVTTNV |
Rabbit Polyclonal Anti-CHRNA1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CHRNA1 antibody: synthetic peptide directed towards the N terminal of human CHRNA1. Synthetic peptide located within the following region: AGLVLGSEHETRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQLINVD |
CHRNA1 CRISPRa kit - CRISPR gene activation of human cholinergic receptor nicotinic alpha 1 subunit
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Chrna1 CRISPRa kit - CRISPR gene activation of mouse cholinergic receptor, nicotinic, alpha polypeptide 1 (muscle)
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene CHRNA1
| Application | Plasmid of exact quantity for transcript copy number calculation |
qPCR primer pairs and template standards against Homo sapiens gene CHRNA1
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene CHRNA1
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
CHRNA1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Active filters
Target Symbol
- CHRNA1