Products

View as table Download

Rabbit anti-SOD1 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human SOD1

Superoxide Dismutase 1 (SOD1) rabbit polyclonal antibody, Purified

Applications IHC, IP, WB
Reactivities Equine, Guinea Pig, Human, Mouse, Rat
Immunogen Synthetic peptide surrounding amino acid 131 of Human SOD

Rabbit Polyclonal Anti-SOD1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SOD1 antibody: synthetic peptide directed towards the N terminal of human SOD1. Synthetic peptide located within the following region: MATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHE

Carrier-free (BSA/glycerol-free) SOD1 mouse monoclonal antibody, clone OTI8B10 (formerly 8B10)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

Superoxide Dismutase 1 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthesized peptide derived from the Internal region of human SOD-1.

SOD1 (Superoxide Dismutase 1) mouse monoclonal antibody, clone OTI8B10 (formerly 8B10)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get a 15% discount on this product. Use code: “NEURO15".

SOD1 mouse monoclonal antibody, clone 8B10, Biotinylated

Applications FC, IHC, WB
Reactivities Human
Conjugation Biotin

SOD1 (Superoxide Dismutase 1) mouse monoclonal antibody, clone OTI8B10 (formerly 8B10)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated