Germany
Japan
United Kingdom
China
Products
View as table Download
Superoxide Dismutase 1 (SOD1) rabbit polyclonal antibody, Purified
| Applications | IHC, IP, WB |
| Reactivities | Equine, Guinea Pig, Human, Mouse, Rat |
| Immunogen | Synthetic peptide surrounding amino acid 131 of Human SOD |
Rabbit Polyclonal Anti-SOD1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SOD1 antibody: synthetic peptide directed towards the N terminal of human SOD1. Synthetic peptide located within the following region: MATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHE |
USD 545.00
3 Days
Superoxide Dismutase 1 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthesized peptide derived from the Internal region of human SOD-1. |
USD 380.00
4 Weeks
USD 379.00
In Stock
SOD1 (Superoxide Dismutase 1) mouse monoclonal antibody, clone OTI8B10 (formerly 8B10)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
USD 420.00
5 Days
USD 420.00
5 Days
USD 159.00
2 Days
Active filters
Target Symbol
- SOD1
Applications
- IHC