USD 420.00
In Stock
LIPG mouse monoclonal antibody, clone 9C5, Biotinylated
Applications | IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
In Stock
LIPG mouse monoclonal antibody, clone 9C5, Biotinylated
Applications | IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Biotin |
Rabbit anti-GDF15 Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Rat, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human GDF15 |
Rabbit anti-GNAS Polyclonal Antibody
Applications | ICC/IF, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human GNAS |
Rabbit anti-TFRC Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human TFRC |
Rabbit polyclonal Anti-Sema3f Antibody
Applications | IHC, IP, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Sema3f antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: FIHAELIPDSAERNDDKLYFFFRERSAEAPQNPAVYARIGRICLNDDGGH |
USD 485.00
2 Weeks
alpha 1 Fetoprotein (AFP) mouse monoclonal antibody, clone AFP-Y2, Aff - Purified
Applications | ELISA, IP, R, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 485.00
2 Weeks
alpha 1 Fetoprotein (AFP) mouse monoclonal antibody, clone AFP-Y1, Aff - Purified
Applications | ELISA, IP, R, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Transferrin (TF) (alpha+beta) goat polyclonal antibody, Serum
Applications | ID, IP |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Lipoproteins form a heterogeneous system of protein-lipid-carbohydrate complexes which provides highly efficient transport of phospholipids, glycolipids, fatty acids, mono-, di- and triglycerides, cholesterol and cholesterolesters. Concentrations in normal human serum is 230-490 mg/100 ml. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) SERPINA1 mouse monoclonal antibody, clone OTI5B12 (formerly 5B12)
Applications | IHC, IP, WB |
Reactivities | Human, Monkey, Dog |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) SERPINA1 mouse monoclonal antibody, clone OTI9A1 (formerly 9A1)
Applications | FC, IHC, IP, WB |
Reactivities | Human, Monkey, Dog |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) SERPINA1 mouse monoclonal antibody, clone OTI15H10 (formerly 15H10)
Applications | IHC, IP, WB |
Reactivities | Human, Monkey, Dog |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) SERPINA1 mouse monoclonal antibody, clone OTI8E3 (formerly 8E3)
Applications | IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) SERPINA1 mouse monoclonal antibody, clone OTI11G2 (formerly 11G2)
Applications | IHC, IP, WB |
Reactivities | Human, Monkey, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI9C5 (formerly 9C5)
Applications | IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI3G7 (formerly 3G7)
Applications | IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI2H10 (formerly 2H10)
Applications | IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI1B8 (formerly 1B8)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI2D5 (formerly 2D5)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI5C3 (formerly 5C3)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI1D9 (formerly 1D9)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI3C7 (formerly 3C7)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI6E11 (formerly 6E11)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI9F2 (formerly 9F2)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI4C3 (formerly 4C3)
Applications | FC, IF, IHC, IP |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI4C1 (formerly 4C1)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI2E12 (formerly 2E12)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI7C2 (formerly 7C2)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI8F8 (formerly 8F8)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI4A8 (formerly 4A8)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI8E4 (formerly 8E4)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI7D1 (formerly 7D1)
Applications | IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI3C4 (formerly 3C4)
Applications | IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI6B11 (formerly 6B11)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI4D2 (formerly 4D2)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 379.00
In Stock
SERPINA1 mouse monoclonal antibody, clone OTI5B12 (formerly 5B12)
Applications | IHC, IP, WB |
Reactivities | Human, Monkey, Dog |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
SERPINA1 mouse monoclonal antibody, clone OTI5B12 (formerly 5B12), Biotinylated
Applications | IHC, IP, WB |
Reactivities | Human, Monkey, Dog |
Conjugation | Biotin |
USD 420.00
4 Weeks
SERPINA1 mouse monoclonal antibody, clone OTI5B12 (formerly 5B12), HRP conjugated
Applications | IHC, IP, WB |
Reactivities | Human, Monkey, Dog |
Conjugation | HRP |
USD 159.00
2 Days
SERPINA1 mouse monoclonal antibody, clone OTI5B12 (formerly 5B12)
Applications | IHC, IP, WB |
Reactivities | Human, Monkey, Dog |
Conjugation | Unconjugated |
USD 379.00
In Stock
Anti-SERPINA1 mouse monoclonal antibody, clone OTI9A1 (formerly 9A1)
Applications | FC, IHC, IP, WB |
Reactivities | Human, Monkey, Dog |
Conjugation | Unconjugated |
USD 420.00
5 Days
SERPINA1 mouse monoclonal antibody,clone 9A1, Biotinylated
Applications | FC, IHC, IP, WB |
Reactivities | Human, Monkey, Dog |
Conjugation | Biotin |
USD 420.00
5 Days
SERPINA1 mouse monoclonal antibody,clone 9A1, HRP conjugated
Applications | FC, IHC, IP, WB |
Reactivities | Human, Monkey, Dog |
Conjugation | HRP |
USD 159.00
2 Days
Anti-SERPINA1 mouse monoclonal antibody, clone OTI9A1 (formerly 9A1)
Applications | FC, IHC, IP, WB |
Reactivities | Human, Monkey, Dog |
Conjugation | Unconjugated |
USD 379.00
In Stock
SERPINA1 mouse monoclonal antibody, clone OTI15H10 (formerly 15H10)
Applications | IHC, IP, WB |
Reactivities | Human, Monkey, Dog |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
SERPINA1 mouse monoclonal antibody, clone OTI15H10 (formerly 15H10), Biotinylated
Applications | IHC, IP, WB |
Reactivities | Human, Monkey, Dog |
Conjugation | Biotin |
USD 420.00
4 Weeks
SERPINA1 mouse monoclonal antibody, clone OTI15H10 (formerly 15H10), HRP conjugated
Applications | IHC, IP, WB |
Reactivities | Human, Monkey, Dog |
Conjugation | HRP |
USD 159.00
2 Days
SERPINA1 mouse monoclonal antibody, clone OTI15H10 (formerly 15H10)
Applications | IHC, IP, WB |
Reactivities | Human, Monkey, Dog |
Conjugation | Unconjugated |
USD 379.00
In Stock
SERPINA1 mouse monoclonal antibody, clone OTI8E3 (formerly 8E3)
Applications | IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
SERPINA1 mouse monoclonal antibody, clone OTI8E3 (formerly 8E3), Biotinylated
Applications | IHC, IP, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
SERPINA1 mouse monoclonal antibody, clone OTI8E3 (formerly 8E3), HRP conjugated
Applications | IHC, IP, WB |
Reactivities | Human |
Conjugation | HRP |
USD 159.00
2 Days
SERPINA1 mouse monoclonal antibody, clone OTI8E3 (formerly 8E3)
Applications | IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |