Products

View as table Download

PDGF AA (PDGFA) (PDGF-AA) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, FN, IHC, WB
Reactivities Human
Immunogen Highly pure (>98%) E.coli derived recombinant Human PDGF-AA (Cat.-No PA118).

PDGF AA (PDGFA) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 121-160 of Human PDGF-A.

PDGF AA (PDGFA) (PDGF-AA) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, FN, IHC, WB
Reactivities Human
Immunogen Highly pure (>98%) recombinant hPDGF-AA

Rabbit Polyclonal Anti-PDGFA Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-PDGFA Antibody: A synthesized peptide

PDGF AA (PDGFA) (PDGF-AA) rabbit polyclonal antibody, Biotin

Applications ELISA, WB
Reactivities Human
Conjugation Biotin
Immunogen Highly pure (>98%) E.coli derived recombinant Human PDGF-AA (Cat.-No PA118)

PDGF AA (PDGFA) (PDGF-AA) rabbit polyclonal antibody, Biotin

Applications ELISA, WB
Reactivities Human
Conjugation Biotin
Immunogen Highly pure (>98%) E.coli derived recombinant Human PDGF-AA (Cat.-No PA118)

Rabbit Polyclonal Anti-PDGFA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PDGFA antibody is: synthetic peptide directed towards the C-terminal region of Human PDGFA. Synthetic peptide located within the following region: HRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTDVR