CCR4 mouse monoclonal antibody, clone KH-4F5, Purified
Applications | ELISA, FC, IF, WB |
Reactivities | Human |
CCR4 mouse monoclonal antibody, clone KH-4F5, Purified
Applications | ELISA, FC, IF, WB |
Reactivities | Human |
CCR4 (Extracell. Dom.) goat polyclonal antibody, Aff - Purified
Applications | ELISA, FC, IHC, WB |
Reactivities | Human, Monkey |
Immunogen | Synthetic corresponding to Human CCR4 extracellular domain. Epitope: Extracellular Domain. |
Rabbit Polyclonal Anti-CCR4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CCR4 antibody: synthetic peptide directed towards the middle region of human CCR4. Synthetic peptide located within the following region: TERNHTYCKTKYSLNSTTWKVLSSLEINILGLVIPLGIMLFCYSMIIRTL |
CCR4 rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Canine, Human, Mouse |
Immunogen | Synthetic peptide surrounding amino acid 32 of human CCR4 |