Products

View as table Download

Rabbit Polyclonal Antibody against PHPT1 (C-term)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This PHPT1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 88-117 amino acids from the C-terminal region of human PHPT1.

PHPT1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PHPT1

Rabbit Polyclonal Anti-MTMR1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MTMR1 antibody: synthetic peptide directed towards the C terminal of human MTMR1. Synthetic peptide located within the following region: KEDVYTKTISLWSYINSQLDEFSNPFFVNYENHVLYPVASLSHLELWVNY

PHPT1 (N-term) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human
Immunogen This PHPT1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human PHPT1.

MTMR6 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 114-143 amino acids from the N-terminal region of Human MTMR6.

TPK1 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide selected from the N-terminal region of Human TPK1

Rabbit Polyclonal Antibody against PHPT1 (N-term)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This PHPT1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human PHPT1.

Rabbit polyclonal antibody to Myotubularin related protein 2 (myotubularin related protein 2)

Applications IHC, WB
Reactivities Human
Immunogen Recombinant fragment corresponding to a region within amino acids 221 and 527 of MTMR2 (Uniprot ID#Q13614)

NFS1 (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen Synthetic peptide - KLH conjugated - corresponding to the central region (between 120-149aa) of human NFS1

Anti-PHPT1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

Rabbit Polyclonal Anti-NFS1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-NFS1 Antibody: synthetic peptide directed towards the middle region of human NFS1. Synthetic peptide located within the following region: TTQTEHKCVLDSCRSLEAEGFQVTYLPVQKSGIIDLKELEAAIQPDTSLV

Rabbit Polyclonal Anti-MTMR7 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-MTMR7 Antibody is: synthetic peptide directed towards the C-terminal region of Human MTMR7. Synthetic peptide located within the following region: NLKSSDPDLSANSDQESGVEDLSCRSPSGGEHAPSEDSGKDRDSDEAVFL

Rabbit Polyclonal Anti-TPK1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TPK1 Antibody: synthetic peptide directed towards the N terminal of human TPK1. Synthetic peptide located within the following region: WNKALLRACADGGANRLYDITEGERESFLPEFINGDFDSIRPEVREYYAT

Rabbit Polyclonal Anti-THTPA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-THTPA antibody is: synthetic peptide directed towards the N-terminal region of Human THTPA. Synthetic peptide located within the following region: KFLPGPGTEERLQELGGTLEYRVTFRDTYYDTPELSLMQADHWLRRREDS

Carrier-free (BSA/glycerol-free) MTMR2 mouse monoclonal antibody, clone OTI2D2 (formerly 2D2)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) MTMR2 mouse monoclonal antibody, clone OTI1F10 (formerly 1F10)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) MTMR2 mouse monoclonal antibody, clone OTI1H8 (formerly 1H8)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) MTMR2 mouse monoclonal antibody, clone OTI5G5 (formerly 5G5)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NFS1 mouse monoclonal antibody, clone OTI2H5 (formerly 2H5)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NFS1 mouse monoclonal antibody, clone OTI5D1 (formerly 5D1)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) THTPA mouse monoclonal antibody, clone OTI13E3 (formerly 13E3)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) THTPA mouse monoclonal antibody, clone OTI4H2 (formerly 4H2)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (glycerol/BSA-free) THTPA mouse monoclonal antibody, clone OTI3E10 (formerly 3E10)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (glycerol/BSA-free) THTPA mouse monoclonal antibody, clone OTI3H7 (formerly 3H7)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) THTPA mouse monoclonal antibody, clone OTI2D5 (formerly 2D5)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) THTPA mouse monoclonal antibody, clone OTI5F7 (formerly 5F7)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) THTPA mouse monoclonal antibody, clone OTI4B5 (formerly 4B5)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) THTPA mouse monoclonal antibody, clone OTI4C11 (formerly 4C11)

Applications WB
Reactivities Human
Conjugation Unconjugated

MTMR6 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated

MTMR2 mouse monoclonal antibody, clone OTI2D2 (formerly 2D2)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

MTMR2 mouse monoclonal antibody, clone OTI2D2 (formerly 2D2)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

MTMR2 mouse monoclonal antibody, clone OTI1F10 (formerly 1F10)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

MTMR2 mouse monoclonal antibody, clone OTI1F10 (formerly 1F10)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

MTMR2 mouse monoclonal antibody, clone OTI1H8 (formerly 1H8)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

MTMR2 mouse monoclonal antibody, clone OTI1H8 (formerly 1H8)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

MTMR2 mouse monoclonal antibody, clone OTI5G5 (formerly 5G5)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

MTMR2 mouse monoclonal antibody, clone OTI5G5 (formerly 5G5)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

NFS1 mouse monoclonal antibody, clone OTI2H5 (formerly 2H5)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

NFS1 mouse monoclonal antibody, clone OTI2H5 (formerly 2H5), HRP conjugated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

NFS1 mouse monoclonal antibody, clone OTI2H5 (formerly 2H5)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

NFS1 mouse monoclonal antibody, clone OTI5D1 (formerly 5D1)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated