Rabbit Polyclonal HIF-2 alpha Antibody
Applications | IHC, WB |
Reactivities | Fish, Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A peptide derived from the C-terminus of mouse/human HIF-2 alpha protein. |
Rabbit Polyclonal HIF-2 alpha Antibody
Applications | IHC, WB |
Reactivities | Fish, Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A peptide derived from the C-terminus of mouse/human HIF-2 alpha protein. |
Mouse monoclonal Hsp70/Hsc70 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat, Bovine, C.elegans, Beluga, Canine, Chicken, Drosophila, Fish, Guinea pig, Hamster, Monkey, Pig, Plant, Rabbit, Sheep, Xenopus |
Conjugation | Unconjugated |
Mouse Monoclonal anti-Hsc70 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Sheep, Dog, Beluga, Bovine, Fish, Guinea porcine, Scallop porcine, Hamster, Rabbit, Chicken, Xenopus, Drosophila, Yeast |
Conjugation | Unconjugated |
Rabbit Polyclonal anti-CALR Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat, Bovine, Dog, Chicken, Drosophila, Fish, Guinea Porcine, Hamster, Monkey, Porcine, Rabbit, Sheep |
Conjugation | Unconjugated |
Immunogen | Human calreticulin synthetic peptide with a cysteine residue added and the peptide conjugated to KLH |
Rabbit polyclonal anti-ATR antibody
Applications | WB |
Reactivities | Fish, Human, Monkey, Mouse, Rat, Xenopus, Dog |
Conjugation | Unconjugated |
Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of human ATR protein. |
Rabbit Polyclonal Anti-OMA1 Antibody
Applications | WB |
Reactivities | Fish, Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-OMA1 antibody: synthetic peptide directed towards the middle region of human OMA1. Synthetic peptide located within the following region: WAICPRDSLALLCQWIQSKLQEYMFNRPYSRKLEAEADKIGLLLAAKACA |
Goat Polyclonal Antibody against TRPM7
Applications | WB |
Reactivities | Mouse, Rat, CrayFish |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-TKESESTNSVRLML, from the C Terminus of the protein sequence according to NP_060142.2. |
Mouse Monoclonal anti-Hsc70 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat, Sheep, Dog, Beluga, Bovine, Fish, Guinea porcine, Scallop porcine, Hamster, Rabbit, Chicken, Xenopus, Drosophila, Yeast |
Conjugation | Unconjugated |
Mouse monoclonal Hsp70 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat, Amphibian, Chicken, Fish, Saccharomyces cerevisiae, Fruit Fly |
Conjugation | Unconjugated |
Chicken Polyclonal NF-M Antibody
Applications | IF, WB |
Reactivities | Chicken, Feline, Fish, Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The C-terminal extension of rat Neurofilament Medium protein (the so-called KE segment) [UniProt# P12839] |
Rabbit polyclonal anti-PCNA antibody
Applications | WB |
Reactivities | Bovine, Chicken, Fish, Human, Monkey, Mouse, Rat, Xenopus, Dog |
Conjugation | Unconjugated |
Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of human PCNA protein. |
Mouse monoclonal Hsp70 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat, Amphibian, Chicken, Fish, Saccharomyces cerevisiae, Fruit Fly |
Conjugation | Unconjugated |
Mouse monoclonal Hsp70 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat, Amphibian, Chicken, Fish, Saccharomyces cerevisiae, Fruit Fly |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-HSPA1L Antibody
Applications | WB |
Reactivities | Human, Lamprey, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-HSPA1L Antibody: synthetic peptide directed towards the C terminal of human HSPA1L. Synthetic peptide located within the following region: DEFDHKRKELEQMCNPIITKLYQGGCTGPACGTGYVPGRPATGPTIEEVD |
Rabbit Polyclonal SOX2 Antibody
Applications | WB |
Reactivities | Fish, Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Reacts with residues 113-127 of the 37 kDa (predicted molecular weight is 34 kDa) human, mouse and rat SOX-2 protein. Sequence is 100% conserved in most species. |
gamma Tubulin Rabbit polyclonal Antibody
Applications | FC, IF, IHC, IP, WB |
Reactivities | Chicken, Fish, Hamster, Human, Monkey, Mouse, Rat, Xenopus, Dog, Cow |
Conjugation | Unconjugated |
Immunogen | A synthesized peptide derived from human Tubulin gamma |
Anti-Connexin 35/36 (Ser276) Antibody
Applications | IHC, WB |
Reactivities | Fish, Mouse, Rabbit |
Conjugation | Unconjugated |
Immunogen | Synthetic phospho-peptide corresponding to amino acid residues of perch connexin 35/36 surrounding Ser276, conjugated to keyhole limpet hemocyanin (KLH). |