Goat Polyclonal Antibody against Silver homologue / Pmel 17
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence CPIGENSPLLSGQQ, from the C Terminus of the protein sequence according to NP_008859.1. |
Goat Polyclonal Antibody against Silver homologue / Pmel 17
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence CPIGENSPLLSGQQ, from the C Terminus of the protein sequence according to NP_008859.1. |
Rabbit Polyclonal Anti-SILV Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SILV antibody: synthetic peptide directed towards the N terminal of human SILV. Synthetic peptide located within the following region: HFLRNQPLTFALQLHDPSGYLAEADLSYTWDFGDSSGTLISRALVVTHTY |
Carrier-free (BSA/glycerol-free) SILV mouse monoclonal antibody, clone OTI9G3 (formerly 9G3)
Applications | IF, IHC, WB |
Reactivities | Human, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SILV mouse monoclonal antibody, clone OTI8A4 (formerly 8A4)
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SILV mouse monoclonal antibody, clone OTI10E5 (formerly 10E5)
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SILV mouse monoclonal antibody, clone OTI1E5 (formerly 1E5)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SILV mouse monoclonal antibody, clone OTI6D5 (formerly 6D5)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SILV mouse monoclonal antibody, clone OTI3G5 (formerly 3G5)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SILV mouse monoclonal antibody, clone OTI4H4 (formerly 4H4)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
PMEL Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 25-300 of human PMEL (NP_008859.1). |
Modifications | Unmodified |
Anti-SILV (Melanoma gp100) mouse monoclonal antibody, clone OTI9G3 (formerly 9G3)
Applications | IF, IHC, WB |
Reactivities | Human, Dog |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
Anti-SILV (Melanoma gp100) mouse monoclonal antibody, clone OTI9G3 (formerly 9G3), Biotinylated
Applications | IF, IHC, WB |
Reactivities | Human, Dog |
Conjugation | Biotin |
USD 420.00
4 Weeks
Anti-SILV (Melanoma gp100) mouse monoclonal antibody, clone OTI9G3 (formerly 9G3), HRP conjugated
Applications | IF, IHC, WB |
Reactivities | Human, Dog |
Conjugation | HRP |
Anti-SILV (Melanoma gp100) mouse monoclonal antibody, clone OTI9G3 (formerly 9G3)
Applications | IF, IHC, WB |
Reactivities | Human, Dog |
Conjugation | Unconjugated |
Anti-SILV (Melanoma gp100) mouse monoclonal antibody, clone OTI8A4 (formerly 8A4)
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Rat, Dog |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
Anti-SILV (Melanoma gp100) mouse monoclonal antibody, clone OTI8A4 (formerly 8A4), Biotinylated
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Rat, Dog |
Conjugation | Biotin |
USD 420.00
4 Weeks
Anti-SILV (Melanoma gp100) mouse monoclonal antibody, clone OTI8A4 (formerly 8A4), HRP conjugated
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Rat, Dog |
Conjugation | HRP |
Anti-SILV (Melanoma gp100) mouse monoclonal antibody, clone OTI8A4 (formerly 8A4)
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Rat, Dog |
Conjugation | Unconjugated |
Anti-SILV (Melanoma gp100) mouse monoclonal antibody, clone OTI10E5 (formerly 10E5)
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Rat, Dog |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
Anti-SILV (Melanoma gp100) mouse monoclonal antibody, clone OTI10E5 (formerly 10E5), Biotinylated
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Rat, Dog |
Conjugation | Biotin |
USD 420.00
4 Weeks
Anti-SILV (Melanoma gp100) mouse monoclonal antibody, clone OTI10E5 (formerly 10E5), HRP conjugated
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Rat, Dog |
Conjugation | HRP |
Anti-SILV (Melanoma gp100) mouse monoclonal antibody, clone OTI10E5 (formerly 10E5)
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Rat, Dog |
Conjugation | Unconjugated |
SILV (Melanoma gp100) mouse monoclonal antibody, clone OTI1E5 (formerly 1E5)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
SILV (Melanoma gp100) mouse monoclonal antibody, clone OTI1E5 (formerly 1E5), Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
SILV (Melanoma gp100) mouse monoclonal antibody, clone OTI1E5 (formerly 1E5), HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
SILV (Melanoma gp100) mouse monoclonal antibody, clone OTI1E5 (formerly 1E5)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
SILV (Melanoma gp100) mouse monoclonal antibody, clone OTI6D5 (formerly 6D5)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
SILV (Melanoma gp100) mouse monoclonal antibody, clone OTI6D5 (formerly 6D5), Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
SILV (Melanoma gp100) mouse monoclonal antibody, clone OTI6D5 (formerly 6D5), HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
SILV (Melanoma gp100) mouse monoclonal antibody, clone OTI6D5 (formerly 6D5)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
SILV (Melanoma gp100) mouse monoclonal antibody, clone OTI3G5 (formerly 3G5)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
SILV (Melanoma gp100) mouse monoclonal antibody, clone OTI3G5 (formerly 3G5), Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
SILV (Melanoma gp100) mouse monoclonal antibody, clone OTI3G5 (formerly 3G5), HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
SILV (Melanoma gp100) mouse monoclonal antibody, clone OTI3G5 (formerly 3G5)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
SILV (Melanoma gp100) mouse monoclonal antibody, clone OTI4H4 (formerly 4H4)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
SILV (Melanoma gp100) mouse monoclonal antibody, clone OTI4H4 (formerly 4H4), Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
SILV (Melanoma gp100) mouse monoclonal antibody, clone OTI4H4 (formerly 4H4), HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
SILV (Melanoma gp100) mouse monoclonal antibody, clone OTI4H4 (formerly 4H4)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |