Products

View as table Download

Rabbit Polyclonal Anti-ATP2A1 Antibody

Applications IHC, WB
Reactivities Human, Macaque
Conjugation Unconjugated
Immunogen The immunogen for anti-ATP2A1 antibody: synthetic peptide directed towards the N terminal of human ATP2A1. Synthetic peptide located within the following region: MEAAHAKTTEECLAYFGVSETTGLTPDQVKRNLEKYGLNELPAEEGKTLW

ATP2A1 (522-613) mouse monoclonal antibody, clone 1B11, Purified

Applications ELISA, IF, IHC, WB
Reactivities Human

Rabbit Polyclonal Anti-ATP2A1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human ATP2A1

Rabbit polyclonal anti-ATP2A1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ATP2A1.

Rabbit Polyclonal Anti-SERCA1

Applications IF, IHC, WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)TPDQVKRHLEKYG, corresponding to amino acid residues 25-37 of rat SERCA1. Cytoplasmic, N-terminus.

ATP2A1 Antibody - middle region

Applications WB
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human ATP2A1

SERCA1/ATP2A1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 350-600 of human SERCA1/SERCA1/ATP2A1 (NP_775293.1).
Modifications Unmodified