Germany
Japan
United Kingdom
China
ATP2A1 (Myc-DDK-tagged)-Human ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 (ATP2A1), transcript variant a
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Atp2a1 (Myc-DDK-tagged) - Mouse ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 (Atp2a1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ATP2A1 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN414911 is the updated version of KN214911.
Atp2a1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN501776 is the updated version of KN301776.
Atp2a1 (GFP-tagged) - Mouse ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 (Atp2a1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Atp2a1 (Myc-DDK-tagged) - Mouse ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 (Atp2a1)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Atp2a1 (Myc-DDK-tagged) - Mouse ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 (Atp2a1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Atp2a1 (mGFP-tagged) - Mouse ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 (Atp2a1)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Atp2a1 (GFP-tagged) - Mouse ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 (Atp2a1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 (ATP2A1), transcript variant a, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ATP2A1 (Myc-DDK tagged) - Human ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 (ATP2A1), transcript variant a, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 (ATP2A1), transcript variant a, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ATP2A1 (mGFP-tagged) - Human ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 (ATP2A1), transcript variant a, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
ATP2A1 (Myc-DDK-tagged)-Human ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 (ATP2A1), transcript variant b
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti-ORF clone of ATP2A1 (Myc-DDK-tagged)-Human ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 (ATP2A1), transcript variant b
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ATP2A1 (Myc-DDK-tagged)-Human ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 (ATP2A1), transcript variant b, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of ATP2A1 (mGFP-tagged)-Human ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 (ATP2A1), transcript variant b
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ATP2A1 (mGFP-tagged)-Human ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 (ATP2A1), transcript variant b, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
ATP2A1 (myc-DDK-tagged) - Human ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 (ATP2A1), transcript variant c
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ATP2A1 (GFP-tagged) - Human ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 (ATP2A1), transcript variant a
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ATP2A1 (GFP-tagged) - Human ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 (ATP2A1), transcript variant b
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Atp2a1 (Myc-DDK-tagged ORF) - Rat ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 (Atp2a1), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Atp2a1 (Myc-DDK-tagged ORF) - Rat ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 (Atp2a1), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Atp2a1 (Myc-DDK-tagged ORF) - Rat ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 (Atp2a1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Atp2a1 (mGFP-tagged ORF) - Rat ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 (Atp2a1), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Atp2a1 (GFP-tagged ORF) - Rat ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 (Atp2a1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Rabbit Polyclonal Anti-ATP2A1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Macaque |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATP2A1 antibody: synthetic peptide directed towards the N terminal of human ATP2A1. Synthetic peptide located within the following region: MEAAHAKTTEECLAYFGVSETTGLTPDQVKRNLEKYGLNELPAEEGKTLW |
Atp2a1 (untagged) - Mouse ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 (Atp2a1), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Transient overexpression lysate of ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 (ATP2A1), transcript variant a
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
ATP2A1 (untagged)-Human ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 (ATP2A1), transcript variant a
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit polyclonal anti-ATP2A1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ATP2A1. |
ATP2A1 CRISPRa kit - CRISPR gene activation of human ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 1
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Atp2a1 CRISPRa kit - CRISPR gene activation of mouse ATPase, Ca++ transporting, cardiac muscle, fast twitch 1
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qSTAR qPCR primer pairs against Homo sapiens gene ATP2A1
ATP2A1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
qSTAR qPCR primer pairs against Mus musculus gene Atp2a1
ATP2A1 MS Standard C13 and N15-labeled recombinant protein (NP_775293)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
ATP2A1 (GFP-tagged) - Human ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 (ATP2A1), transcript variant c
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Atp2a1 (untagged ORF) - Rat ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 (Atp2a1), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
3`UTR clone of ATPase Ca++ transporting cardiac muscle fast twitch 1 (ATP2A1) transcript variant a for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
3`UTR clone of ATPase Ca++ transporting cardiac muscle fast twitch 1 (ATP2A1) transcript variant b for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
ATP2A1 (untagged)-Human ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 (ATP2A1), transcript variant b
| Vector | pCMV6 series |
| Tag | Tag Free |
ATP2A1 (untagged) - Human ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 (ATP2A1), transcript variant c
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
ATP2A1 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Atp2a1 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Atp2a1 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Active filters
Target Symbol
- ATP2A1