ERCC3 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ERCC3 |
ERCC3 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ERCC3 |
Rabbit polyclonal antibody to XPB (excision repair cross-complementing rodent repair deficiency, complementation group 3 (xeroderma pigmentosum group B complementing))
Applications | IF, WB |
Reactivities | Human |
Immunogen | Recombinant fragment corresponding to a region within amino acids 521 and 742 of XPB (Uniprot ID#P19447) |
Anti-ERCC3 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 270 amino acids of human excision repair cross-complementing rodent repair deficiency, complementation group 3 |
Rabbit Polyclonal Anti-ERCC3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ERCC3 antibody: synthetic peptide directed towards the N terminal of human ERCC3. Synthetic peptide located within the following region: MGKRDRADRDKKKSRKRHYEDEEDDEEDAPGNDPQEAVPSAAGKQVDESG |
Carrier-free (BSA/glycerol-free) ERCC3 mouse monoclonal antibody,clone OTI6H8
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ERCC3 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ERCC3 |
ERCC3 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ERCC3 |
ERCC3 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 512-782 of human ERCC3 (NP_000113.1). |
Modifications | Unmodified |
ERCC3 mouse monoclonal antibody,clone OTI6H8
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
ERCC3 mouse monoclonal antibody,clone OTI6H8, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
ERCC3 mouse monoclonal antibody,clone OTI6H8, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
ERCC3 mouse monoclonal antibody,clone OTI6H8
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |