LOC102723996 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 216-246 amino acids from the C-terminal region of human CD275 / ICOS Ligand |
LOC102723996 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 216-246 amino acids from the C-terminal region of human CD275 / ICOS Ligand |
Rabbit Polyclonal Anti-ICOSLG Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ICOSLG antibody is: synthetic peptide directed towards the N-terminal region of Human ICOSLG. Synthetic peptide located within the following region: VDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEV |
Carrier-free (BSA/glycerol-free) ICOSLG mouse monoclonal antibody, clone OTI2G10 (formerly 2G10)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ICOSLG mouse monoclonal antibody, clone OTI1D10 (formerly 1D10)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ICOSLG mouse monoclonal antibody, clone OTI1B8 (formerly 1B8)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ICOSLG mouse monoclonal antibody, clone OTI2C5 (formerly 2C5)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-ICOSLG Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ICOSLG |
ICOSL Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 19-256 of human ICOSL (NP_056074.1). |
Modifications | Unmodified |
ICOSLG mouse monoclonal antibody, clone OTI2G10 (formerly 2G10)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
ICOSLG mouse monoclonal antibody, clone OTI2G10 (formerly 2G10), Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
ICOSLG mouse monoclonal antibody, clone OTI2G10 (formerly 2G10), HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
ICOSLG mouse monoclonal antibody, clone OTI2G10 (formerly 2G10)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
ICOSLG mouse monoclonal antibody, clone OTI1D10 (formerly 1D10)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
ICOSLG mouse monoclonal antibody, clone OTI1D10 (formerly 1D10), Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
ICOSLG mouse monoclonal antibody, clone OTI1D10 (formerly 1D10), HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
ICOSLG mouse monoclonal antibody, clone OTI1D10 (formerly 1D10)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
ICOSLG mouse monoclonal antibody, clone OTI1B8 (formerly 1B8)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
ICOSLG mouse monoclonal antibody, clone OTI1B8 (formerly 1B8), Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
ICOSLG mouse monoclonal antibody, clone OTI1B8 (formerly 1B8), HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
ICOSLG mouse monoclonal antibody, clone OTI1B8 (formerly 1B8)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
ICOSLG mouse monoclonal antibody, clone OTI2C5 (formerly 2C5)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
ICOSLG mouse monoclonal antibody, clone OTI2C5 (formerly 2C5), Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
ICOSLG mouse monoclonal antibody, clone OTI2C5 (formerly 2C5), HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
ICOSLG mouse monoclonal antibody, clone OTI2C5 (formerly 2C5)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
ICOSLG (B7H2, CD275) mouse monoclonal antibody,clone UMAB254
Applications | 10k-ChIP, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ICOSLG (B7H2, CD275) mouse monoclonal antibody,clone UMAB254
Applications | 10k-ChIP, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
ICOSLG (B7H2, CD275) mouse monoclonal antibody,clone UMAB254
Applications | 10k-ChIP, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |