Products

Jump to Filters
View as table Download
Perilipin-1 (PLIN1) Guinea Pig Polyclonal Antibody
BP5015

USD 400.00

2 Weeks

Perilipin-1 (PLIN1) guinea pig polyclonal antibody, Serum

Applications IHC, WB
Reactivities Bovine, Human, Mouse, Rat
Immunogen Duplicated N-terminus of Perilipin, aa 1-20 (cf. Greenberg et al. 1992, JBC 266, 11341-11346)
Perilipin-1 (PLIN1) Mouse Monoclonal Antibody [Clone ID: PERI112.17]
AM09128SU-N

USD 320.00

2 Weeks

Perilipin-1 (PLIN1) mouse monoclonal antibody, clone PERI112.17, Supernatant

Applications IF, IHC, WB
Reactivities Bovine, Human, Mouse, Rat
Perilipin-1 (PLIN1) Rabbit Polyclonal Antibody
TA319013

USD 355.00

3 Weeks

Rabbit polyclonal anti-Perilipin A antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide surrounding amino acid 510 of mouse Perilipin A.
Perilipin-1 (PLIN1) (488-499) Goat Polyclonal Antibody
AP22521PU-N

USD 440.00

2 Weeks

Perilipin-1 (PLIN1) (488-499) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human, Monkey
Immunogen Synthetic peptide from internal region of human PLIN
Perilipin-1 (PLIN1) Rabbit Polyclonal Antibody
TA309806

USD 457.00

5 Days

Rabbit Polyclonal Perilipin Antibody

Applications WB
Reactivities Bovine, Human, Mouse, Porcine, Rat, Sheep
Conjugation Unconjugated
Immunogen A synthetic peptide made to a region between residues 450-522 (C-terminus) of the human perilipin protein. [Swiss-Prot# O60240]
Perilipin-1 (PLIN1) Rabbit Polyclonal Antibody
TA346328

USD 410.00

5 Days

Rabbit Polyclonal Anti-PLIN Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PLIN antibody: synthetic peptide directed towards the N terminal of human PLIN. Synthetic peptide located within the following region: STQFTAANELACRGLDHLEEKIPALQYPPEKIASELKDTISTRLRSARNS
Perilipin-1 (PLIN1) (C-term) Goat Polyclonal Antibody
AP22522PU-N

USD 440.00

2 Weeks

Perilipin-1 (PLIN1) (C-term) goat polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Bovine, Canine, Equine, Human, Monkey, Mouse
Immunogen Synthetic peptide from (C-term) of human PLIN
Perilipin-1 (PLIN1) (C-term) Guinea Pig Polyclonal Antibody
BP5033

USD 395.00

2 Weeks

Perilipin-1 (PLIN1) (C-term) guinea pig polyclonal antibody, Serum

Applications IHC, WB
Reactivities Bovine, Human
Immunogen C-terminus of Perilipin-1 (hCTA/B; aa 507-519; cf. Greenberg et al. 1992, JBC 266, 11341-11346)
Perilipin-1 (PLIN1) Goat Polyclonal Antibody
TA303218

USD 375.00

5 Days

Goat Polyclonal Antibody against PLIN

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-PREKPKRRVSDS, from the internal region (near the C Terminus) of the protein sequence according to NP_002657.2.
Perilipin-1 (PLIN1) Goat Polyclonal Antibody
TA303219

USD 375.00

5 Days

Goat Polyclonal Antibody against PLIN (C-terminal)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-EPILGRAQYSQLRKK, from the C Terminus of the protein sequence according to NP_002657.2.
Perilipin-1 (PLIN1) Rabbit Polyclonal Antibody
TA351513

USD 345.00

In Stock

Rabbit Polyclonal Anti-PLIN1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PLIN1
Perilipin-1 (PLIN1) Rabbit Polyclonal Antibody
TA351514

USD 345.00

In Stock

Rabbit Polyclonal Anti-PLIN1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PLIN1