Rabbit polyclonal anti-TNF12 antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human TNF12. |
Rabbit polyclonal anti-TNF12 antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human TNF12. |
Rabbit Polyclonal TWEAK Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | TWEAK antibody was raised against recombinant human TWEAK protein. |
TNFSF12-TNFSF13 rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide, corresponding to amino acids 51-100 of Human TWEAK. |
Rabbit Polyclonal Anti-TNFSF12 Antibody
Applications | WB |
Reactivities | Human |
Immunogen | The immunogen for anti-TNFSF12 antibody: synthetic peptide directed towards the N terminal of human TNFSF12. Synthetic peptide located within the following region: QEELVAEEDQDPSELNPQTEESQDPAPFLNRLVRPRRSAPKGRKTRARRA |
Rabbit Polyclonal Anti-TNFSF12 Antibody
Applications | WB |
Reactivities | Human |
Immunogen | The immunogen for anti-TNFSF12 antibody: synthetic peptide directed towards the N terminal of human TNFSF12. Synthetic peptide located within the following region: LGLLLAVVSLGSRASLSAQEPAQEELVAEEDQDPSELNPQTEESQDPAPF |
TNFSF12 Rabbit polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human TNFSF12 |
Modifications | Unmodified |