Germany
Japan
United Kingdom
China
TNFSF12 (Myc-DDK-tagged)-Human tumor necrosis factor (ligand) superfamily, member 12 (TNFSF12), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Tnfsf12 (Myc-DDK-tagged) - Mouse tumor necrosis factor (ligand) superfamily, member 12 (Tnfsf12)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, Tnfsf12 (Myc-DDK-tagged) - Mouse tumor necrosis factor (ligand) superfamily, member 12 (Tnfsf12), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, Tnfsf12 (GFP-tagged) - Mouse tumor necrosis factor (ligand) superfamily, member 12 (Tnfsf12), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
USD 820.00
6 Weeks
Lenti ORF particles, TNFSF12 (Myc-DDK tagged) - Human tumor necrosis factor (ligand) superfamily, member 12 (TNFSF12), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 820.00
6 Weeks
Lenti ORF particles, TNFSF12 (mGFP-tagged) - Human tumor necrosis factor (ligand) superfamily, member 12 (TNFSF12), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Tnfsf12 (GFP-tagged) - Mouse tumor necrosis factor (ligand) superfamily, member 12-member 13 (cDNA clone MGC:106105 IMAGE:3482756), complete
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Tnfsf12 (GFP-tagged) - Mouse tumor necrosis factor (ligand) superfamily member 12 (Tnfsf12), (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
TNFSF12 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN421007 is the updated version of KN221007.
Tnfsf12 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN517995 is the updated version of KN317995.
Tnfsf12Tnfsf13 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN517996 is the updated version of KN317996.
Lenti ORF clone of Tnfsf12 (Myc-DDK-tagged) - Mouse tumor necrosis factor (ligand) superfamily, member 12 (Tnfsf12)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Tnfsf12 (Myc-DDK-tagged) - Mouse tumor necrosis factor (ligand) superfamily, member 12 (Tnfsf12), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Tnfsf12 (mGFP-tagged) - Mouse tumor necrosis factor (ligand) superfamily, member 12 (Tnfsf12)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Tnfsf12 (GFP-tagged) - Mouse tumor necrosis factor (ligand) superfamily, member 12 (Tnfsf12), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 820.00
6 Weeks
Lenti ORF particles, TNFSF12 (Myc-DDK tagged) - Human tumor necrosis factor (ligand) superfamily, member 12 (TNFSF12), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 820.00
6 Weeks
Lenti ORF particles, TNFSF12 (mGFP-tagged) - Human tumor necrosis factor (ligand) superfamily, member 12 (TNFSF12), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
TNFSF12 (GFP-tagged) - Human tumor necrosis factor (ligand) superfamily, member 12 (TNFSF12), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Tnfsf12 (Myc-DDK-tagged ORF) - Rat tumor necrosis factor ligand superfamily member 12 (Tnfsf12), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Tnfsf12 (Myc-DDK-tagged ORF) - Rat tumor necrosis factor ligand superfamily member 12 (Tnfsf12), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Tnfsf12 (Myc-DDK-tagged ORF) - Rat tumor necrosis factor ligand superfamily member 12 (Tnfsf12), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Tnfsf12 (mGFP-tagged ORF) - Rat tumor necrosis factor ligand superfamily member 12 (Tnfsf12), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Tnfsf12 (GFP-tagged ORF) - Rat tumor necrosis factor ligand superfamily member 12 (Tnfsf12), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Tnfsf12 (mGFP-tagged) - Mouse tumor necrosis factor (ligand) superfamily, member 12 (Tnfsf12)
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
TNFSF12 (untagged)-Human tumor necrosis factor (ligand) superfamily, member 12 (TNFSF12), transcript variant 1
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Tnfsf12 (untagged) - Mouse tumor necrosis factor (ligand) superfamily, member 12 (Tnfsf12), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human tumor necrosis factor (ligand) superfamily, member 12 (TNFSF12), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Tnfsf12 (Myc-DDK-tagged) - Mouse tumor necrosis factor (ligand) superfamily, member 12 (Tnfsf12)
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human tumor necrosis factor (ligand) superfamily, member 12 (TNFSF12), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human tumor necrosis factor (ligand) superfamily, member 12 (TNFSF12), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Tnfsf12 (untagged ORF) - Rat tumor necrosis factor ligand superfamily member 12 (Tnfsf12), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
TNFSF12 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of tumor necrosis factor (ligand) superfamily, member 12 (TNFSF12)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
qSTAR qPCR primer pairs against Homo sapiens gene TNFSF12
Mouse Anti-Human CD255 (TWEAK) Purified (25 ug)
| Reactivities | Human |
Anti-Human TWEAK Goat Polyclonal Antibody
| Applications | ELISA |
| Reactivities | Human |
| Immunogen | E.coli derived Recombinant Human TWEAK |
Rabbit Polyclonal Anti-TNFSF12 Antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | The immunogen for anti-TNFSF12 antibody: synthetic peptide directed towards the N terminal of human TNFSF12. Synthetic peptide located within the following region: QEELVAEEDQDPSELNPQTEESQDPAPFLNRLVRPRRSAPKGRKTRARRA |
Rabbit Polyclonal Anti-TNFSF12 Antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | The immunogen for anti-TNFSF12 antibody: synthetic peptide directed towards the N terminal of human TNFSF12. Synthetic peptide located within the following region: LGLLLAVVSLGSRASLSAQEPAQEELVAEEDQDPSELNPQTEESQDPAPF |
Tnfsf12 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Human TNFSF12 ELISA Kit
| Assay Type | Sandwich ELISA kit of Quantitative Detection for Human TNFSF12 |
| Reactivities | Human |
Mouse TNFSF12/TWEAK ELISA Kit
| Assay Type | Sandwich ELISA kit of Quantitative Detection for Mouse TNFSF12/TWEAK |
| Reactivities | Mouse |
Rat TNFSF12/TWEAK ELISA Kit
| Assay Type | Sandwich ELISA kit of Quantitative Detection for Rat TNFSF12/TWEAK |
| Reactivities | Rat |
TNFSF12 CRISPRa kit - CRISPR gene activation of human TNF superfamily member 12
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Tnfsf12 CRISPRa kit - CRISPR gene activation of mouse tumor necrosis factor (ligand) superfamily, member 12
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qSTAR qPCR primer pairs against Mus musculus gene Tnfsf12
3`UTR clone of tumor necrosis factor (ligand) superfamily member 12 (TNFSF12) for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
Active filters
Target Symbol
- TNFSF12