Products

cDNA Clones (7)
Antibodies (1)
Proteins (1)
Jump to Filters
View as table Download
SKIP (INPP5K) (NM_016532) Human Tagged ORF Clone
RC200092

USD 98.00

USD 560.00

In Stock

INPP5K (Myc-DDK-tagged)-Human inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
SKIP (INPP5K) (NM_130766) Human Tagged ORF Clone
RC212090

USD 420.00

In Stock

INPP5K (Myc-DDK-tagged)-Human inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
SKIP (INPP5K) (NM_001135642) Human Tagged ORF Clone
RC227852

USD 420.00

In Stock

INPP5K (Myc-DDK-tagged)-Human inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
SKIP (INPP5K) (NM_016532) Human Tagged ORF Clone
RG200092

USD 460.00

In Stock

INPP5K (GFP-tagged) - Human inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
SKIP (INPP5K) Rabbit Polyclonal Antibody
TA343120

USD 375.00

In Stock

Rabbit Polyclonal Anti-INPP5K Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-INPP5K antibody: synthetic peptide directed towards the C terminal of human INPP5K. Synthetic peptide located within the following region: PPTYKFDRNSNDYDTSEKKRKPAWTDRILWRLKRQPCAGPDTPIPPASHF
SKIP (INPP5K) (NM_016532) Human Tagged Lenti ORF Clone
RC200092L1

USD 768.00

In Stock

Lenti ORF clone of Human inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
SKIP (INPP5K) (NM_016532) Human Untagged Clone
SC321576

USD 310.00

In Stock

INPP5K (untagged)-Human inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
SC321576 is the updated version of SC128048.
SKIP (INPP5K) (NM_130766) Human Untagged Clone
SC108235

USD 760.00

In Stock

INPP5K (untagged)-Human inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None