Products

cDNA Clones (10)
RNAi (3)
Antibodies (1)
Proteins (1)
Jump to Filters
View as table Download
hnRNP U (HNRNPU) (NM_004501) Human Tagged ORF Clone
RC201627

USD 420.00

In Stock

HNRNPU (Myc-DDK-tagged)-Human heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A) (HNRNPU), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
hnRNP U (HNRNPU) (NM_004501) Human Recombinant Protein
TP301627

USD 823.00

In Stock

Recombinant protein of human heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A) (HNRNPU), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Hnrnpu (NM_016805) Mouse Tagged ORF Clone
MR210713

USD 840.00

In Stock

Hnrnpu (Myc-DDK-tagged) - Mouse heterogeneous nuclear ribonucleoprotein U (Hnrnpu)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
hnRNP U (HNRNPU) (NM_031844) Human Tagged ORF Clone
RC214320

USD 610.00

In Stock

HNRNPU (Myc-DDK-tagged)-Human heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A) (HNRNPU), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
hnRNP U (HNRNPU) (NM_004501) Human Tagged ORF Clone
RG201627

USD 460.00

In Stock

HNRNPU (GFP-tagged) - Human heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A) (HNRNPU), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
hnRNP U (HNRNPU) Rabbit Polyclonal Antibody
TA345875

USD 475.00

In Stock

Rabbit Polyclonal Anti-HNRNPU Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HNRNPU antibody: synthetic peptide directed towards the C terminal of human HNRNPU. Synthetic peptide located within the following region: EITYVELQKEEAQKLLEQYKEESKKALPPEKKQNTGSKKSNKNKSGKNQF
Hnrnpu (NM_016805) Mouse Untagged Clone
MC200653

USD 210.00

In Stock

Hnrnpu (untagged) - Mouse heterogeneous nuclear ribonucleoprotein U (Hnrnpu), (10ug)

Vector PCMV6-Kan/Neo
Tag Tag Free
Mammalian Cell Selection Neomycin
Hnrnpu (NM_016805) Mouse Tagged ORF Clone
MR210713L4

USD 1,284.00

In Stock

Lenti ORF clone of Hnrnpu (mGFP-tagged) - Mouse heterogeneous nuclear ribonucleoprotein U (Hnrnpu)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
hnRNP U (HNRNPU) (NM_004501) Human Tagged ORF Clone
RC201627L1

USD 768.00

In Stock

Lenti ORF clone of Human heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A) (HNRNPU), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
hnRNP U (HNRNPU) (NM_004501) Human Untagged Clone
SC109317

USD 310.00

In Stock

HNRNPU (untagged)-Human heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A) (HNRNPU), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
HNRNPU Human siRNA Oligo Duplex (Locus ID 3192)
SR302175

USD 430.00

In Stock

HNRNPU (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

hnRNP U (HNRNPU) (NM_031844) Human Untagged Clone
SC107014

USD 1,670.00

In Stock

HNRNPU (untagged)-Human heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A) (HNRNPU), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
hnRNP U (HNRNPU) (NM_004501) Human Untagged Clone
SC323776

USD 310.00

In Stock

HNRNPU (untagged)-Human heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A) (HNRNPU), transcript variant 2

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
Hnrnpu Rat siRNA Oligo Duplex (Locus ID 117280)
SR509679

USD 430.00

In Stock

Hnrnpu (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

Hnrnpu Mouse siRNA Oligo Duplex (Locus ID 51810)
SR420257

USD 430.00

In Stock

Hnrnpu (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).