Products

View as table Download

Rabbit Polyclonal Anti-PUS7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PUS7 antibody: synthetic peptide directed towards the N terminal of human PUS7. Synthetic peptide located within the following region: FADMMKHGLTEADVGITKFVSSHQGFSGILKERYSDFVVHEIGKDGRISH

Carrier-free (BSA/glycerol-free) PUS7 mouse monoclonal antibody, clone OTI5F12 (formerly 5F12)

Applications FC, IF, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PUS7 mouse monoclonal antibody, clone OTI4C6 (formerly 4C6)

Applications FC, IF, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PUS7 mouse monoclonal antibody, clone OTI4H5 (formerly 4H5)

Applications FC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PUS7 mouse monoclonal antibody, clone OTI4A2 (formerly 4A2)

Applications WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated

PUS7 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 352-661 of human PUS7 (NP_061915.2).
Modifications Unmodified

PUS7 mouse monoclonal antibody, clone OTI5F12 (formerly 5F12)

Applications FC, IF, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

PUS7 mouse monoclonal antibody, clone OTI5F12 (formerly 5F12)

Applications FC, IF, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

PUS7 mouse monoclonal antibody, clone OTI4C6 (formerly 4C6)

Applications FC, IF, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

PUS7 mouse monoclonal antibody, clone OTI4C6 (formerly 4C6)

Applications FC, IF, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

PUS7 mouse monoclonal antibody, clone OTI4H5 (formerly 4H5)

Applications FC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

PUS7 mouse monoclonal antibody, clone OTI4H5 (formerly 4H5)

Applications FC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

PUS7 mouse monoclonal antibody, clone OTI4A2 (formerly 4A2)

Applications WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated

PUS7 mouse monoclonal antibody, clone OTI4A2 (formerly 4A2)

Applications WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated