Products

View as table Download

Rabbit Polyclonal Anti-HMG20A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HMG20A antibody: synthetic peptide directed towards the N terminal of human HMG20A. Synthetic peptide located within the following region: ENLMTSSTLPPLFADEDGSKESNDLATTGLNHPEVPYSSGATSSTNNPEF

Rabbit Polyclonal Anti-HMG20A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HMG20A antibody: synthetic peptide directed towards the C terminal of human HMG20A. Synthetic peptide located within the following region: SMPLPGSGETPTVDTIDSYMNRLHSIILANPQDNENFIATVREVVNRLDR

Goat Anti-HMG20A Antibody

Applications IHC
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence C-ATVREVVNRLDR, from the C Terminus of the protein sequence according to NP_060670.1.

Rabbit Polyclonal anti-HMG20A antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HMG20A antibody: synthetic peptide directed towards the N terminal of human HMG20A. Synthetic peptide located within the following region: MENLMTSSTLPPLFADEDGSKESNDLATTGLNHPEVPYSSGATSSTNNPE

Rabbit Polyclonal Anti-HMG20A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HMG20A antibody: synthetic peptide directed towards the middle region of human HMG20A. Synthetic peptide located within the following region: RKTQDRQKGKSHRQDAARQATHDHEKETEVKERSVFDIPIFTEEFLNHSK

Rabbit Polyclonal Anti-HMG20A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HMG20A antibody: synthetic peptide directed towards the middle region of human HMG20A. Synthetic peptide located within the following region: RKTQDRQKGKSHRQDAARQATHDHEKETEVKERSVFDIPIFTEEFLNHSK

Carrier-free (BSA/glycerol-free) HMG20A mouse monoclonal antibody, clone OTI5E4 (formerly 5E4)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) HMG20A mouse monoclonal antibody, clone OTI5G3 (formerly 5G3)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) HMG20A mouse monoclonal antibody, clone OTI5E3 (formerly 5E3)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) HMG20A mouse monoclonal antibody, clone OTI2H4 (formerly 2H4)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) HMG20A mouse monoclonal antibody, clone OTI1C2 (formerly 1C2)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

HMG20A mouse monoclonal antibody, clone OTI5E4 (formerly 5E4)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

HMG20A mouse monoclonal antibody, clone OTI5E4 (formerly 5E4)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

HMG20A mouse monoclonal antibody, clone OTI5G3 (formerly 5G3)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

HMG20A mouse monoclonal antibody, clone OTI5G3 (formerly 5G3), Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

HMG20A mouse monoclonal antibody, clone OTI5G3 (formerly 5G3), HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

HMG20A mouse monoclonal antibody, clone OTI5G3 (formerly 5G3)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

HMG20A mouse monoclonal antibody, clone OTI5E3 (formerly 5E3)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

HMG20A mouse monoclonal antibody, clone OTI5E3 (formerly 5E3)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

HMG20A mouse monoclonal antibody, clone OTI2H4 (formerly 2H4)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

HMG20A mouse monoclonal antibody, clone OTI2H4 (formerly 2H4), Biotinylated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

HMG20A mouse monoclonal antibody, clone OTI2H4 (formerly 2H4), HRP conjugated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

HMG20A mouse monoclonal antibody, clone OTI2H4 (formerly 2H4)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

HMG20A mouse monoclonal antibody, clone OTI1C2 (formerly 1C2)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

HMG20A mouse monoclonal antibody, clone OTI1C2 (formerly 1C2)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated