Nogo A (RTN4) (Isoform 1) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide corresponding to the C-terminal of human Nogo-A |
Nogo A (RTN4) (Isoform 1) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide corresponding to the C-terminal of human Nogo-A |
Rabbit Polyclonal NogoA Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | NogoA antibody was raised against a 23 amino acid peptide from near the amino terminus of human NogoA. |
Anti-RTN4 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 1179-1194 amino acids of Human reticulon 4 |
Rabbit Polyclonal NogoA Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | NogoA antibody was raised against a 19 amino acid peptide from near the center of human NogoA. |
Nogo A (RTN4) (501-515) goat polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Human, Monkey |
Immunogen | Synthetic peptide from an internal region of human RTN4 / Nogo (NP_065393.1; NP_997404.1) |
Rabbit Polyclonal Nogo Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic sequence corresponding to amino acids 14-30 (DSPPRPQPAFKYQFVRE) of human Nogo A was used as the immunogen for this antibody. |
Rabbit Polyclonal Anti-RTN4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RTN4 antibody: synthetic peptide directed towards the middle region of human RTN4. Synthetic peptide located within the following region: FRIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNCTI |
Rabbit Polyclonal Anti-RTN4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RTN4 antibody: synthetic peptide directed towards the middle region of human RTN4. Synthetic peptide located within the following region: RAYLESEVAISEELVQKYSNSALGHVNCTIKELRRLFLVDDLVDSLKFAV |
Anti-RTN4 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 1179-1192 amino acids of Human reticulon 4 |