Products

View as table Download

Goat Polyclonal Antibody against FOXC1

Applications FC, WB
Reactivities Human, Mouse, Zebrafish
Conjugation Unconjugated
Immunogen Peptide with sequence RTSGAFVYDCSKF, from the C Terminus of the protein sequence according to NP_001444.1.

Rabbit Polyclonal Anti-FOXC1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FOXC1 antibody: synthetic peptide directed towards the N terminal of human FOXC1. Synthetic peptide located within the following region: GGYTAMPAPMSVYSHPAHAEQYPGGMARAYGPYTPQPQPKDMVKPPYSYI

Rabbit polyclonal anti-FOXC1/2 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human FOXC1/2.
Modifications Phospho-specific

Rabbit Polyclonal Anti-FOXC1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FOXC1 antibody: synthetic peptide directed towards the C terminal of human FOXC1. Synthetic peptide located within the following region: GERGGHLQGAPGGAGGSAVDNPLPDYSLPPVTSSSSSSLSHGGGGGGGGG

Rabbit Polyclonal Anti-FOXC1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FOXC1 antibody: synthetic peptide directed towards the C terminal of human FOXC1. Synthetic peptide located within the following region: QQNFHSVREMFESQRIGLNNSPVNGNSSCQMAFPSSQSLYRTSGAFVYDC

Rabbit Polyclonal Anti-Foxc1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Foxc1 antibody: synthetic peptide directed towards the n terminal of mouse Foxc1. Synthetic peptide located within the following region: MQARYSVSSPNSLGVVPYLGGEQSYYRAAAAAAGGGYTAMPAPMSVYSHP

Rabbit Polyclonal Anti-FOXC1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human FOXC1

FOXC1 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 404-553 of human FOXC1 (NP_001444.2).
Modifications Unmodified

FOXC1 Rabbit monoclonal Antibody

Applications IP, WB
Reactivities Mouse
Conjugation Unconjugated