Rabbit Polyclonal SIRT6 Antibody
Applications | IHC, WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to a C-terminal region of the mouse SIRT6 protein (within residues 250-334). [Swiss-Prot P59941] |
Rabbit Polyclonal SIRT6 Antibody
Applications | IHC, WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to a C-terminal region of the mouse SIRT6 protein (within residues 250-334). [Swiss-Prot P59941] |
Chicken Polyclonal SIRT6 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | SIRT6 antibody was raised against a 17 amino acid synthetic peptide near the carboxy terminus of human SIRT6. |
Rabbit Polyclonal Anti-SIRT6 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SIRT6 antibody: synthetic peptide directed towards the N terminal of human SIRT6. Synthetic peptide located within the following region: STASGIPDFRGPHGVWTMEERGLAPKFDTTFESARPTQTHMALVQLERVG |
Carrier-free (BSA/glycerol-free) SIRT6 mouse monoclonal antibody, clone OTI1G3 (formerly 1G3)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-SIRT6 Rabbit Polyclonal Antibody
Applications | ELISA, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 35-274 amino acids of human sirtuin 6 |
SIRT6 Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human SIRT6. |
SIRT6 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of mouse SIRT6 (NP_001156902.1). |
Modifications | Unmodified |
SIRT6 mouse monoclonal antibody, clone OTI1G3 (formerly 1G3)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
SIRT6 mouse monoclonal antibody, clone OTI1G3 (formerly 1G3), Biotinylated
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
SIRT6 mouse monoclonal antibody, clone OTI1G3 (formerly 1G3), HRP conjugated
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
SIRT6 mouse monoclonal antibody, clone OTI1G3 (formerly 1G3)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |