Germany
Japan
United Kingdom
China
Products
ARG1 rabbit polyclonal antibody, Azide Free
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Bovine |
| Immunogen | Arginase isolated and purified from Calf liver. Freund's complete adjuvant is used in the first step of the immunization procedure. |
ARG1 rabbit polyclonal antibody, Biotin
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Bovine |
| Conjugation | Biotin |
| Immunogen | Arginase isolated and purified from Calf liver. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Rabbit anti-ARG1 Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ARG1 |
Goat Anti-Arginase I Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Pig |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CFGLAREGNHKPID, from the C Terminus of the protein sequence according to NP_000036.2. |
Goat Polyclonal Antibody against Arg1 (C-terminal)
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-NHKPETDYLKPPK, from the C Terminus of the protein sequence according to NP_058830.2. |
Rabbit polyclonal ARG1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ARG1. |
Rabbit Polyclonal Anti-ARG1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ARG1 antibody: synthetic peptide directed towards the N terminal of human ARG1. Synthetic peptide located within the following region: HSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLK |
Rabbit Polyclonal Anti-ARG1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ARG1 antibody: synthetic peptide directed towards the C terminal of human ARG1. Synthetic peptide located within the following region: LDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPK |
Goat Polyclonal Antibody against ARG1
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-REGNHKPIDYLNPPK, from the C Terminus of the protein sequence according to NP_000036.2. |
Rabbit Polyclonal Anti-ARG1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ARG1 antibody: synthetic peptide directed towards the N terminal of human ARG1. Synthetic peptide located within the following region: SAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYG |
Rabbit anti ARG1 Polyclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ARG1 mouse monoclonal antibody,clone OTI1H4
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ARG1 mouse monoclonal antibody,clone OTI4D7
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ARG1 mouse monoclonal antibody,clone OTI3C8
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ARG1 mouse monoclonal antibody,clone OTI2E7
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Anti-Arginase I (ARG1) Antibody
| Applications | IHC, WB |
| Reactivities | Guinea Pig, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full-length recombinant rat liver arginase I expressed in and purified from E. Coli. |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
ARG1 mouse monoclonal antibody,clone OTI1H4
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
ARG1 mouse monoclonal antibody,clone OTI1H4, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
ARG1 mouse monoclonal antibody,clone OTI1H4, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
ARG1 mouse monoclonal antibody,clone OTI1H4
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
ARG1 mouse monoclonal antibody,clone OTI4D7
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
ARG1 mouse monoclonal antibody,clone OTI4D7, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
ARG1 mouse monoclonal antibody,clone OTI4D7, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
ARG1 mouse monoclonal antibody,clone OTI4D7
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
ARG1 mouse monoclonal antibody,clone OTI3C8
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
ARG1 mouse monoclonal antibody,clone OTI3C8, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
ARG1 mouse monoclonal antibody,clone OTI3C8, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
ARG1 mouse monoclonal antibody,clone OTI3C8
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
ARG1 mouse monoclonal antibody,clone OTI2E7
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
ARG1 mouse monoclonal antibody,clone OTI2E7, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
ARG1 mouse monoclonal antibody,clone OTI2E7, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
ARG1 mouse monoclonal antibody,clone OTI2E7
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Category
-
- Antibodies
-
-
-
Target Symbol
- ARG1