Products

View as table Download

Rabbit Polyclonal Anti-CMAS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CMAS antibody: synthetic peptide directed towards the N terminal of human CMAS. Synthetic peptide located within the following region: GRGVEKPPHLAALILARGGSKGIPLKNIKHLAGVPLIGWVLRAALDSGAF

Rabbit polyclonal antibody to CMAS (cytidine monophosphate N-acetylneuraminic acid synthetase)

Applications IF, WB
Reactivities Human
Immunogen Recombinant fragment corresponding to a region within amino acids 69 and 414 of CMAS (Uniprot ID#Q8NFW8)

Rabbit polyclonal anti-CMAS antibody (C-term)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CMAS antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 300-327 amino acids from the C-terminal region of human CMAS.

CMAS Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human CMAS

CMAS Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human CMAS

CMAS rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CMAS

CMAS rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CMAS

CMAS Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-263 of human CMAS (NP_061156.1).
Modifications Unmodified