Germany
Japan
United Kingdom
China
CMAS (Myc-DDK-tagged)-Human cytidine monophosphate N-acetylneuraminic acid synthetase (CMAS)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, CMAS (mGFP-tagged) - Human cytidine monophosphate N-acetylneuraminic acid synthetase (CMAS), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, CMAS (Myc-DDK tagged) - Human cytidine monophosphate N-acetylneuraminic acid synthetase (CMAS), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, CMAS (mGFP-tagged) - Human cytidine monophosphate N-acetylneuraminic acid synthetase (CMAS), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Recombinant protein of human cytidine monophosphate N-acetylneuraminic acid synthetase (CMAS)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Cmas (Myc-DDK-tagged) - Mouse cytidine monophospho-N-acetylneuraminic acid synthetase (Cmas). Note: ORF is codon optimized
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CMAS (GFP-tagged) - Human cytidine monophosphate N-acetylneuraminic acid synthetase (CMAS)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CMAS - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN423608 is the updated version of KN223608.
Cmas - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN503509 is the updated version of KN303509.
Cmas (GFP-tagged) - Mouse cytidine monophospho-N-acetylneuraminic acid synthetase (Cmas). Note: ORF is codon optimized
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Cmas (Myc-DDK-tagged) - Mouse cytidine monophospho-N-acetylneuraminic acid synthetase (Cmas). Note: ORF is codon optimized
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Cmas (Myc-DDK-tagged) - Mouse cytidine monophospho-N-acetylneuraminic acid synthetase (Cmas), 200ul, >10^7 TU/mL. Note: ORF is codon optimized
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Cmas (mGFP-tagged) - Mouse cytidine monophospho-N-acetylneuraminic acid synthetase (Cmas). Note: ORF is codon optimized
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Cmas (GFP-tagged) - Mouse cytidine monophospho-N-acetylneuraminic acid synthetase (Cmas), 200ul, >10^7 TU/mL. Note: ORF is codon optimized
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human cytidine monophosphate N-acetylneuraminic acid synthetase (CMAS), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CMAS (Myc-DDK tagged) - Human cytidine monophosphate N-acetylneuraminic acid synthetase (CMAS), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human cytidine monophosphate N-acetylneuraminic acid synthetase (CMAS), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Cmas (Myc-DDK-tagged ORF) - Rat cytidine monophosphate N-acetylneuraminic acid synthetase (Cmas), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Cmas (Myc-DDK-tagged ORF) - Rat cytidine monophosphate N-acetylneuraminic acid synthetase (Cmas), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Cmas (Myc-DDK-tagged ORF) - Rat cytidine monophosphate N-acetylneuraminic acid synthetase (Cmas), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Cmas (mGFP-tagged ORF) - Rat cytidine monophosphate N-acetylneuraminic acid synthetase (Cmas), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Cmas (GFP-tagged ORF) - Rat cytidine monophosphate N-acetylneuraminic acid synthetase (Cmas), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Rabbit Polyclonal Anti-CMAS Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CMAS antibody: synthetic peptide directed towards the N terminal of human CMAS. Synthetic peptide located within the following region: GRGVEKPPHLAALILARGGSKGIPLKNIKHLAGVPLIGWVLRAALDSGAF |
Cmas (untagged) - Mouse cytidine monophospho-N-acetylneuraminic acid synthetase (Cmas), (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human cytidine monophosphate N-acetylneuraminic acid synthetase (CMAS), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human cytidine monophosphate N-acetylneuraminic acid synthetase (CMAS), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
CMAS HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
CMAS (untagged)-Human cytidine monophosphate N-acetylneuraminic acid synthetase (CMAS)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Transient overexpression lysate of cytidine monophosphate N-acetylneuraminic acid synthetase (CMAS)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Rabbit polyclonal anti-CMAS antibody (C-term)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CMAS antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 300-327 amino acids from the C-terminal region of human CMAS. |
CMAS - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
CMAS CRISPRa kit - CRISPR gene activation of human cytidine monophosphate N-acetylneuraminic acid synthetase
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Cmas CRISPRa kit - CRISPR gene activation of mouse cytidine monophospho-N-acetylneuraminic acid synthetase
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene CMAS
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene CMAS
qPCR primer pairs and template standards against Mus musculus gene Cmas
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Mus musculus gene Cmas
CMAS MS Standard C13 and N15-labeled recombinant protein (NP_061156)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Cmas (untagged ORF) - Rat cytidine monophosphate N-acetylneuraminic acid synthetase (Cmas), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
3`UTR clone of cytidine monophosphate N-acetylneuraminic acid synthetase (CMAS) for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
CMAS (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Cmas (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Cmas (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
CMAS Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human CMAS |
CMAS Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human CMAS |
CMAS rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CMAS |
CMAS Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-263 of human CMAS (NP_061156.1). |
| Modifications | Unmodified |
Transient overexpression of CMAS (NM_018686) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Active filters
Target Symbol
- CMAS