Collagen VI (COL6A1) rabbit polyclonal antibody, Purified
Applications | ELISA, IF, IHC, R |
Reactivities | Bovine, Chicken, Human, Mouse, Porcine, Rat |
Immunogen | Purified collagen type VI from human placenta. |
Collagen VI (COL6A1) rabbit polyclonal antibody, Purified
Applications | ELISA, IF, IHC, R |
Reactivities | Bovine, Chicken, Human, Mouse, Porcine, Rat |
Immunogen | Purified collagen type VI from human placenta. |
Collagen VI (COL6A1) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, IF, IHC, IP, WB |
Reactivities | Bovine, Human |
Collagen VI (COL6A1) rabbit polyclonal antibody, Purified
Applications | ELISA, IHC, IP, WB |
Reactivities | Bovine, Human, Mammalian |
Immunogen | Collagen type VI purified from Human and Bovine placenta. |
Collagen VI (COL6A1) rabbit polyclonal antibody, Biotin
Applications | ELISA, IHC, IP, WB |
Reactivities | Bovine, Human, Mammalian |
Conjugation | Biotin |
Immunogen | Collagen type VI purified from Human and Bovine placenta. |
Collagen VI (COL6A1) goat polyclonal antibody, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
Immunogen | Human type VI collagen. Antiserum to human type VI collagen was raised by repeated immunisation of goats with highly purified antigen. |
Collagen VI (COL6A1) goat polyclonal antibody, Azide Free
Applications | ELISA, IF, IHC |
Reactivities | Human |
Immunogen | Collagen VI antibody was raised against Human type VI Collagen. |
Collagen VI (COL6A1) rabbit polyclonal antibody, Purified
Applications | ELISA, IF, IHC, R |
Reactivities | Bovine, Chicken, Human, Mouse, Porcine, Rat |
Immunogen | Purified collagen type VI from human placenta. |
Collagen VI (COL6A1) rabbit polyclonal antibody, Purified
Applications | ELISA, IHC, IP, WB |
Reactivities | Bovine, Human, Mammalian |
Immunogen | Collagen type VI purified from Human and Bovine placenta. |
Collagen VI (COL6A1) rabbit polyclonal antibody, Purified
Applications | ELISA, IHC |
Reactivities | Human, Mouse |
Immunogen | Synthetic peptide - KLH conjugated |
Collagen VI (COL6A1) alpha 1 chain rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human COL6A1 |
Collagen VI (COL6A1) alpha 1 chain rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human COL6A1 |
Rabbit Polyclonal Anti-COL6A1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-COL6A1 antibody: synthetic peptide directed towards the middle region of human COL6A1. Synthetic peptide located within the following region: ADITILLDGSASVGSHNFDTTKRFAKRLAERFLTAGRTDPAHDVRVAVVQ |
Carrier-free (BSA/glycerol-free) COL6A1 mouse monoclonal antibody,clone OTI1G8
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Collagen VI/COL6A1 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 19-250 of human Collagen VI/Collagen VI/COL6A1 (NP_001839.2). |
Modifications | Unmodified |
COL6A1 mouse monoclonal antibody,clone OTI1G8
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: "KO15".
USD 420.00
2 Weeks
COL6A1 mouse monoclonal antibody,clone OTI1G8, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
2 Weeks
COL6A1 mouse monoclonal antibody,clone OTI1G8, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
COL6A1 mouse monoclonal antibody,clone OTI1G8
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |