Germany
Japan
United Kingdom
China
COL6A1 (Myc-DDK-tagged)-Human collagen, type VI, alpha 1 (COL6A1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Col6a1 (GFP-tagged) - Mouse collagen type VI alpha 1 (Col6a1), (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Recombinant protein of human collagen, type VI, alpha 1 (COL6A1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
COL6A1 (GFP-tagged) - Human collagen, type VI, alpha 1 (COL6A1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Col6a1 (Myc-DDK-tagged) - Mouse collagen, type VI, alpha 1 (Col6a1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Col6a1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN503646 is the updated version of KN303646.
Lenti ORF clone of Col6a1 (Myc-DDK-tagged) - Mouse collagen, type VI, alpha 1 (Col6a1)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Col6a1 (Myc-DDK-tagged) - Mouse collagen, type VI, alpha 1 (Col6a1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Col6a1 (mGFP-tagged) - Mouse collagen, type VI, alpha 1 (Col6a1)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Col6a1 (GFP-tagged) - Mouse collagen, type VI, alpha 1 (Col6a1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human collagen, type VI, alpha 1 (COL6A1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 1,280.00
6 Weeks
Lenti ORF particles, COL6A1 (Myc-DDK tagged) - Human collagen, type VI, alpha 1 (COL6A1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human collagen, type VI, alpha 1 (COL6A1), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 1,280.00
6 Weeks
Lenti ORF particles, COL6A1 (mGFP-tagged) - Human collagen, type VI, alpha 1 (COL6A1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Col6a1 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
| E. coli Selection | Chloramphenicol (34 ug/ml) |
| Mammalian Cell Selection | Puromycin |
Col6a1 - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
COL6A1 (untagged)-Human collagen, type VI, alpha 1 (COL6A1)
| Vector | pCMV6-XL6 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Collagen VI (COL6A1) rabbit polyclonal antibody, Purified
| Applications | ELISA, IF, IHC, R |
| Reactivities | Bovine, Chicken, Human, Mouse, Porcine, Rat |
| Immunogen | Purified collagen type VI from human placenta. |
Collagen VI (COL6A1) rabbit polyclonal antibody, Purified
| Applications | ELISA, IHC, IP, WB |
| Reactivities | Bovine, Human, Mammalian |
| Immunogen | Collagen type VI purified from Human and Bovine placenta. |
Collagen VI (COL6A1) rabbit polyclonal antibody, Biotin
| Applications | ELISA, IHC, IP, WB |
| Reactivities | Bovine, Human, Mammalian |
| Conjugation | Biotin |
| Immunogen | Collagen type VI purified from Human and Bovine placenta. |
Collagen VI (COL6A1) goat polyclonal antibody, Purified
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Human |
| Immunogen | Human type VI collagen. Antiserum to human type VI collagen was raised by repeated immunisation of goats with highly purified antigen. |
Collagen VI (COL6A1) goat polyclonal antibody, Azide Free
| Applications | ELISA, IF, IHC |
| Reactivities | Human |
| Immunogen | Collagen VI antibody was raised against Human type VI Collagen. |
Collagen VI (COL6A1) rabbit polyclonal antibody, Purified
| Applications | ELISA, IF, IHC, R |
| Reactivities | Bovine, Chicken, Human, Mouse, Porcine, Rat |
| Immunogen | Purified collagen type VI from human placenta. |
Collagen VI (COL6A1) rabbit polyclonal antibody, Purified
| Applications | ELISA, IHC, IP, WB |
| Reactivities | Bovine, Human, Mammalian |
| Immunogen | Collagen type VI purified from Human and Bovine placenta. |
Transient overexpression lysate of collagen, type VI, alpha 1 (COL6A1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
COL6A1 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Collagen VI (COL6A1) rabbit polyclonal antibody, Purified
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide - KLH conjugated |
COL6A1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Collagen type VI human protein, 0.5 mg
| Protein Source | Placenta |
Collagen VI (COL6A1) alpha 1 chain rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human COL6A1 |
Collagen VI (COL6A1) alpha 1 chain rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human COL6A1 |
qSTAR qPCR primer pairs against Mus musculus gene Col6a1
Rabbit Polyclonal Anti-COL6A1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-COL6A1 antibody: synthetic peptide directed towards the middle region of human COL6A1. Synthetic peptide located within the following region: ADITILLDGSASVGSHNFDTTKRFAKRLAERFLTAGRTDPAHDVRVAVVQ |
COL6A1 CRISPRa kit - CRISPR gene activation of human collagen type VI alpha 1 chain
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Col6a1 CRISPRa kit - CRISPR gene activation of mouse collagen, type VI, alpha 1
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene COL6A1
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene COL6A1
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
Col6a1 (untagged) - Mouse collagen, type VI, alpha 1 (Col6a1), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
COL6A1 MS Standard C13 and N15-labeled recombinant protein (NP_001839)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Collagen type VI bovine protein, 0.5 mg
| Protein Source | Placenta |
3`UTR clone of collagen type VI alpha 1 (COL6A1) for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
Col6a1 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Collagen VI/COL6A1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 19-250 of human Collagen VI/Collagen VI/COL6A1 (NP_001839.2). |
| Modifications | Unmodified |
COL6A1 mouse monoclonal antibody,clone OTI1G8
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: "KO15".
USD 420.00
2 Weeks
USD 420.00
2 Weeks
Transient overexpression of COL6A1 (NM_001848) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Active filters
Target Symbol
- COL6A1