Products

View as table Download

Rabbit Polyclonal Anti-MBP(myelin basic protein) Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-MBP(myelin basic protein) Antibody: Peptide sequence around aa.291~295(G-G-R-D-S

Mouse Monoclonal MBP Antibody (2H9)

Applications ELISA, FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
TA336919 is a replacement of AM06698SU-N.

Rabbit Polyclonal Anti-MBP Antibody

Applications IHC, IP, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-MBP Antibody: synthetic peptide directed towards the middle region of human MBP. Synthetic peptide located within the following region: FGGDRGAPKRGSGKDSHHPARTAHYGSLPQKSHGRTQDENPVVHFFKNIV

Myelin Basic Protein (MBP) chicken polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse
Immunogen Synthetic peptide KLH conjugated corresponding to a region of the MBP gene product shared between the Human (NP_002376) and Mouse (NP_034907) sequences.
After repeated injections, immune eggs were collected, the IgY fractions were purified from the yolks, and then affinity-purified using a peptide column.

Myelin Basic Protein / MBP Mouse Monoclonal (N-Terminus) (V/h5) Antibody

Applications IHC
Reactivities Bovine, Guinea Pig, Human, Rabbit, Sheep
Conjugation Unconjugated

Myelin Basic Protein (MBP) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide corresponding to a sequence at the C-terminal of the human MBP

Chicken Anti-Myelin Basic Protein (MBP) Antibody

Applications IF, WB
Reactivities Bovine, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Three peptide sequences conserved in higher vertebrate MBP proteins

MBP Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human MBP

Rabbit Polyclonal MBP Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Reacts with residues 49-62 of Isoforms 5 and 6 of the human protein. The immunogen corresponds to Isoform 1 between amino acids 182-195 of the 33 kDa isoform. The antibody also detects mouse and rat MBP protein. The antibody primarily detects a 22 kDa ban

Anti-MBP Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around aa.291~295(G-G-R-D-S)derived from Human MBP

Rabbit Polyclonal Anti-MBP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-MBP Antibody: synthetic peptide directed towards the middle region of human MBP. Synthetic peptide located within the following region: FKDRPSESDELQTIQEDSAATSESLDVMASQKRPSQRHGSKYLATASTMD

Rabbit anti Myelin Basic Protein Polyclonal Antibody

Reactivities Human
Conjugation Unconjugated

Rabbit anti MBP Polyclonal Antibody

Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit anti MBP (Paired T98) Polyclonal Antibody

Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit anti MBP(pT98) Polyclonal Antibody

Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Myelin Basic Protein Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated

MBP rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human MBP