Germany
Japan
United Kingdom
China
COL1A1 (Myc-DDK-tagged)-Human collagen, type I, alpha 1 (COL1A1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
COL1A1 (untagged)-Human collagen, type I, alpha 1 (COL1A1)
| Vector | pCMV6-XL6 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Collagen I (COL1A1) rabbit polyclonal antibody, Biotin
| Applications | ELISA, FC, IHC, IP, WB |
| Reactivities | Bovine, Human, Mammalian, Mouse, Rat |
| Conjugation | Biotin |
| Immunogen | Collagen Type I from Human and Bovine placenta. |
qSTAR qPCR primer pairs against Homo sapiens gene COL1A1
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
Collagen I (COL1A1) rabbit polyclonal antibody, Purified
| Applications | ELISA, IF, IHC, R |
| Reactivities | Human |
| Immunogen | Purified Collagen type I from Human skin. |
Collagen I (COL1A1) rabbit polyclonal antibody, Azide Free
| Applications | ELISA, IF, IHC |
| Reactivities | Fish |
| Immunogen | Collagen Type I extracted and purified from salmon fish skin. |
Rabbit Polyclonal Anti-COL1A1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-COL1A1 antibody: synthetic peptide directed towards the C terminal of human COL1A1. Synthetic peptide located within the following region: PPGPPSAGFDFSFLPQPPQEKAHDGGRYYRADDANVVRDRDLEVDTTLKS |
Active filters
Target Symbol
- COL1A1
Citations
- Yes