Rabbit Polyclonal Anti-PTHLH Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PTHLH antibody: synthetic peptide directed towards the middle region of human PTHLH. Synthetic peptide located within the following region: YKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLS |
Rabbit polyclonal anti pTH-Related Protein (1-34) (hu, ms, rt); neat antiserum
| Applications | ELISA |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Ala-Val-Ser-Glu-His-Gln-Leu-Leu-His-Asp-Lys-Gly- Lys-Ser-Ile-Gln-Asp-Leu-Arg-Arg-Arg-Phe-Phe-Leu-His-His-Leu-Ile-Ala- Glu-Ile-His-Thr-Ala-OH (Disulfide bond) coupled to carrier protein. |
Rabbit polyclonal anti (Tyr36)-pTH-Related Protein (1-36); neat antiserum
| Applications | ELISA |
| Reactivities | Chicken |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Ala-Val-Ser-Glu-His-Gln-Leu-Leu-His-Asp-Lys-Gly- Lys-Ser-Ile-Gln-Asp-Leu-Arg-Arg-Arg-Phe-Phe-Leu-His-His-Leu-Ile-Ala- Glu-Ile-His-Thr-Ala-OH (Disulfide bond) coupled to carrier protein. |
USD 545.00
2 Weeks
Guinea pig polyclonal anti pTH-Related Protein (1-34) (hu, ms, rt); neat antiserum
| Applications | ELISA |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Ala-Val-Ser-Glu-His-Gln-Leu-Leu-His-Asp-Lys-Gly- Lys-Ser-Ile-Gln-Asp-Leu-Arg-Arg-Arg-Phe-Phe-Leu-His-His-Leu-Ile-Ala- Glu-Ile-His-Thr-Ala-OH (Disulfide bond) coupled to carrier protein. |
Rabbit Polyclonal PTHLH Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Rabbit Polyclonal Anti-Pthlh Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Pthlh antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: EVSPNSKPAPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTPGKKK |
Rabbit polyclonal anti-PTHrP antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E. coli expressed human PTHrP |
Biotinylated Anti-Human PTHrP Rabbit Polyclonal Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived Recombinant Human PTHrP |
Anti-Human PTHrP Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived Recombinant Human PTHrP |
Rabbit polyclonal anti pTH-Related Protein (1-34) (hu, ms, rt); diluted antiserum
| Applications | ELISA |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Ala-Val-Ser-Glu-His-Gln-Leu-Leu-His-Asp-Lys-Gly- Lys-Ser-Ile-Gln-Asp-Leu-Arg-Arg-Arg-Phe-Phe-Leu-His-His-Leu-Ile-Ala- Glu-Ile-His-Thr-Ala-OH (Disulfide bond) coupled to carrier protein. |
Rabbit polyclonal anti human / rat Parathyroid Hormone Related Protein (pTH-Related Protein), (1-34)
| Applications | ELISA |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
Rabbit polyclonal anti (Tyr36)-pTH-Related Protein (1-36) (ck); diluted antiserum
| Applications | ELISA |
| Reactivities | Chicken |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Ala-Val-Ser-Glu-His-Gln-Leu-Leu-His-Asp-Lys-Gly- Lys-Ser-Ile-Gln-Asp-Leu-Arg-Arg-Arg-Ile-Phe-Leu-Gln-Asn-Leu-Ile-Glu- Gly-Val-Asn-Thr-Ala-Glu-Tyr-NH2 coupled to carrier protein. |
Rabbit polyclonal anti (Tyr36)-pTH-Related Protein (1-36) (ck); purified rabbit IgG
| Applications | ELISA |
| Reactivities | Chicken |
| Conjugation | Unconjugated |
Anti-PTHLH Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 37-177 amino acids of human parathyroid hormone-like hormone |
PTHLH Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 25-175 of human PTHLH (NP_945315.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
