Germany
Japan
United Kingdom
China
Products
View as table Download
Rabbit anti-NF-kB p105/p50 (Phospho-Ser337) polyclonal antibody (Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanNF-κB p105/p50 around the phosphorylation site of serine 337 (R-K-SP-D-L). |
| Modifications | Phospho-specific |
Rabbit polyclonal Nuclear Receptor NR4A1 (Ab-351) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Nuclear Receptor NR4A1 around the phosphorylation site of serine 351 (L-P-SP-K-P). |
Rabbit Polyclonal NF- kappaB p105/p50 (Ser932) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human NF- kappaB p105/p50 around the phosphorylation site of Serine 932 |
| Modifications | Phospho-specific |
Rabbit Polyclonal CrkII (Tyr221) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CrkII around the phosphorylation site of Tyrosine 221 |
| Modifications | Phospho-specific |
Rabbit Polyclonal p53 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-p53 antibody: human p53 (tumor protein p53), using a KLH-conjugated synthetic peptide containing a sequence from the C-terminal part of the protein. |
ATF4 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ATF4 |
Rabbit anti-NFKB2 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human NFKB2 |
Rabbit Polyclonal Anti-NFATC2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NFATC2 antibody: synthetic peptide directed towards the C terminal of human NFATC2. Synthetic peptide located within the following region: PTVIQQQNATSQRAAKNGPPVSDQKEVLPAGVTIKQEQNLDQTYLDDVNE |
Rabbit Polyclonal Antibody against MEF2C (S387)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This MEF2C antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 365-394 amino acids from human MEF2C. |
Rabbit Polyclonal MYC Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human MYC |
NFATC2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human NFATC2 |
Rabbit Polyclonal Anti-Atf4 Antibody
| Applications | IF, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Atf4 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: TRYRQKKRAEQEALTGECKELEKKNEALKEKADSLAKEIQYLKDLIEEVR |
c-Myc (MYC) chicken polyclonal antibody, Aff - Purified
| Applications | ELISA, IF, IHC, IP, WB |
| Reactivities | Human |
| Immunogen | Synthetic peptide containing the Human c-myc epitope (i.e., EQKLISEEDL) conjugated to KLH. The first injection included complete Freund's adjuvant; subsequent injections included incomplete Freund's adjuvant. Eggs were collected after the fourth injection, and antibodies were purified from the yolks using a proprietary method that yields a purity of >90%. |
Rabbit Polyclonal c-Jun (Ser73) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human c-Jun around the phosphorylation site of Serine 73 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-NFKB1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human NFKB1 |
Goat Polyclonal Antibody against ATF4
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-EEVRKARGKKRVP, from the C Terminus of the protein sequence according to NP_001666. |
Rabbit Polyclonal antibody to c-Myc (v-myc myelocytomatosis viral oncogene homolog (avian))
| Applications | Assay, FC, IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 1 and 52 of c-Myc (Uniprot ID#P01106) |
Goat Anti-SRF Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QASPSRDSSTDLTQ, from the internal region of the protein sequence according to NP_003122.1. |
Rabbit polyclonal NFkB p65 phospho S536 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to residues surrounding S536 of human p65 (RelA) protein. |
Rabbit polyclonal DDIT3 Antibody (C-term A135)
| Applications | FC, IF, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | This DDIT3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 120-149 amino acids from the C-terminal region of human DDIT3. |
Rabbit polyclonal JUN Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This JUN antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 222-251 amino acids from the C-terminal region of human JUN. |
Rabbit Polyclonal CHOP (Ser30) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CHOP around the phosphorylation site of Serine 30 |
| Modifications | Phospho-specific |
Rabbit Polyclonal NF- kappaB p65 (Ser536) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human NF- kappaB p65 around the phosphorylation site of Serine 536 |
| Modifications | Phospho-specific |
Rabbit polyclonal c-Jun (Phospho-Ser63) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human c-Jun around the phosphorylation site of Serine 63. |
| Modifications | Phospho-specific |
Rabbit polyclonal ATF-4 (Phospho-Ser219) antibody
| Applications | WB |
| Reactivities | H:S219, M:S218 |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human ATF-4. |
| Modifications | Phospho-specific |
CHOP Rabbit Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CHOP |
IKBKB Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human IKBKB |
Rabbit Polyclonal NF-kappaB p65 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human NF-kappaB p65 |
Rabbit anti-FOS Polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human FOS |
Active filters
Clonalities
- Polyclonal
Families
- Transcription Factors
Pathways
- MAPK signaling pathway
Filter by
Category
Target Symbol
- RELA (52)
- TP53 (51)
- JUN (27)
- MYC (25)
- NFKB1 (23)
- ATF2 (22)
- IKBKG (19)
- IKBKB (17)
- FOS (16)
- ATF4 (14)
- NFKB2 (14)
- ELK1 (13)
- MECOM (12)
- MEF2C (12)
- NR4A1 (12)
- TNF (12)
- DDIT3 (11)
- JUND (11)
- TNFRSF1A (11)
- NFATC4 (10)
- RELB (10)
- RPS6KA5 (10)
- SRF (9)
- TGFB1 (9)
- CRK (8)
- MAP2K3 (7)
- NFATC2 (6)
- MAX (5)
- DAXX (4)
- FGF10 (4)
- PPP3CB (4)
- ELK4 (3)
- MAP3K13 (3)
- NLK (3)
- RPS6KA4 (3)
- PPP5C (1)