Products

View as table Download

Rabbit Polyclonal Anti-ARIH2 Antibody - C-terminal region

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Arih2 antibody is: synthetic peptide directed towards the C-terminal region of Rat Arih2. Synthetic peptide located within the following region: YYMESGPRKKLFEYQQAQLEAEIENLSWKVERADSYDRGDLENQMHIAEQ

Rabbit Polyclonal Anti-ARIH2 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ARIH2 antibody: synthetic peptide directed towards the N terminal of human ARIH2. Synthetic peptide located within the following region: MSVDMNSQGSDSNEEDYDPNCEEEEEEEEDDPGDIEDYYVGVASDVEQQG

Rabbit Polyclonal Anti-ARIH2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ARIH2 Antibody: synthetic peptide directed towards the N terminal of human ARIH2. Synthetic peptide located within the following region: EDYDPNCEEEEEEEEDDPGDIEDYYVGVASDVEQQGADAFDPEEYQFTCL

Goat Anti-ARIH2 / TRIAD1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence C-EQRRRTLLKDFHDT, from the C Terminus of the protein sequence according to NP_006312.1.

Rabbit Polyclonal Anti-ARIH2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human ARIH2

ARIH2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human ARIH2

ARIH2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human ARIH2