Products

View as table Download

E3 ubiquitin protein ligase MUL1 (MUL1) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 272-301 aa) of human MUL1 / RNF218

Rabbit Polyclonal Anti-MUL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C1orf166 antibody: synthetic peptide directed towards the middle region of human C1orf166. Synthetic peptide located within the following region: KPLDSVDLGLETVYEKFHPSIQSFTDVIGHYISGERPKGIQETEEMLKVG

Rabbit Polyclonal Anti-MUL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C1orf166 antibody: synthetic peptide directed towards the middle region of human C1orf166. Synthetic peptide located within the following region: GMQYYLSSQDFDSLLQRQESSVRLWKVLALVFGFATCATLFFILRKQYLQ

MUL1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-352 of human MUL1 (NP_078820.2).
Modifications Unmodified