Germany
Japan
United Kingdom
China
USD 450.00
In Stock
MUL1 (Myc-DDK-tagged)-Human mitochondrial E3 ubiquitin protein ligase 1 (MUL1), nuclear gene encoding mitochondrial protein
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Mul1 (Myc-DDK-tagged) - Mouse mitochondrial ubiquitin ligase activator of NFKB 1 (Mul1), nuclear gene encoding mitochondrial protein
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 500.00
In Stock
MUL1 (GFP-tagged) - Human mitochondrial E3 ubiquitin protein ligase 1 (MUL1), nuclear gene encoding mitochondrial protein
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, Mul1 (Myc-DDK-tagged) - Mouse mitochondrial ubiquitin ligase activator of NFKB 1 (Mul1), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, Mul1 (GFP-tagged) - Mouse mitochondrial ubiquitin ligase activator of NFKB 1 (Mul1), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
USD 850.00
3 Weeks
Lenti ORF particles, MUL1 (Myc-DDK tagged) - Human mitochondrial E3 ubiquitin protein ligase 1 (MUL1), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 850.00
6 Weeks
Lenti ORF particles, MUL1 (mGFP-tagged) - Human mitochondrial E3 ubiquitin protein ligase 1 (MUL1), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Mul1 (Myc-DDK-tagged ORF) - Rat mitochondrial ubiquitin ligase activator of NFKB 1 (Mul1), nuclear gene encoding mitochondrial protein, (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Mul1 (GFP-tagged) - Mouse RIKEN cDNA 0610009K11 gene (0610009K11Rik)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 1,290.00
2 Weeks
MUL1 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN404038 is the updated version of KN204038.
Lenti ORF particles, Mul1 (Myc-DDK-tagged) - Mouse mitochondrial ubiquitin ligase activator of NFKB 1 (Mul1), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Mul1 (mGFP-tagged) - Mouse mitochondrial ubiquitin ligase activator of NFKB 1 (Mul1), nuclear gene encoding mitochondrial protein
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Mul1 (GFP-tagged) - Mouse mitochondrial ubiquitin ligase activator of NFKB 1 (Mul1), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 850.00
5 Weeks
Lenti ORF particles, MUL1 (Myc-DDK tagged) - Human mitochondrial E3 ubiquitin protein ligase 1 (MUL1), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 850.00
3 Weeks
Lenti ORF particles, MUL1 (mGFP-tagged) - Human mitochondrial E3 ubiquitin protein ligase 1 (MUL1), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Mul1 (Myc-DDK-tagged ORF) - Rat mitochondrial ubiquitin ligase activator of NFKB 1 (Mul1), nuclear gene encoding mitochondrial protein, (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Mul1 (Myc-DDK-tagged ORF) - Rat mitochondrial ubiquitin ligase activator of NFKB 1 (Mul1), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Mul1 (mGFP-tagged ORF) - Rat mitochondrial ubiquitin ligase activator of NFKB 1 (Mul1), nuclear gene encoding mitochondrial protein, (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Mul1 (GFP-tagged ORF) - Rat mitochondrial ubiquitin ligase activator of NFKB 1 (Mul1), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Mul1 (mGFP-tagged) - Mouse mitochondrial ubiquitin ligase activator of NFKB 1 (Mul1), nuclear gene encoding mitochondrial protein
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
USD 310.00
In Stock
MUL1 (untagged)-Human mitochondrial E3 ubiquitin protein ligase 1 (MUL1), nuclear gene encoding mitochondrial protein
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
USD 310.00
In Stock
MUL1 (untagged)-Human mitochondrial E3 ubiquitin protein ligase 1 (MUL1), nuclear gene encoding mitochondrial protein
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Mul1 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
USD 715.00
In Stock
MUL1 - Human, 4 unique 29mer shRNA constructs in retroviral GFP vector
| Format | Retroviral plasmids |
| Vector | pGFP-V-RS |
Lenti ORF clone of Mul1 (Myc-DDK-tagged) - Mouse mitochondrial ubiquitin ligase activator of NFKB 1 (Mul1), nuclear gene encoding mitochondrial protein
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 650.00
In Stock
Lenti ORF clone of Human mitochondrial E3 ubiquitin protein ligase 1 (MUL1), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Mul1 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Mul1 - Mouse, 4 unique 29mer shRNA constructs in retroviral GFP vector
| Format | Retroviral plasmids |
| Vector | pGFP-V-RS |
Mul1 - Rat, 4 unique 29mer shRNA constructs in retroviral GFP vector
| Format | Retroviral plasmids |
| Vector | pGFP-V-RS |
Lenti ORF clone of Mul1 (Myc-DDK-tagged) - Mouse mitochondrial ubiquitin ligase activator of NFKB 1 (Mul1), nuclear gene encoding mitochondrial protein
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
USD 650.00
3 Weeks
Lenti ORF clone of Human mitochondrial E3 ubiquitin protein ligase 1 (MUL1), nuclear gene encoding mitochondrial protein, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
USD 396.00
5 Days
Transient overexpression lysate of mitochondrial E3 ubiquitin ligase 1 (MUL1), nuclear gene encoding mitochondrial protein
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
USD 815.00
In Stock
MUL1 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
USD 450.00
2 Weeks
E3 ubiquitin protein ligase MUL1 (MUL1) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 272-301 aa) of human MUL1 / RNF218 |
Rabbit Polyclonal Anti-MUL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C1orf166 antibody: synthetic peptide directed towards the middle region of human C1orf166. Synthetic peptide located within the following region: KPLDSVDLGLETVYEKFHPSIQSFTDVIGHYISGERPKGIQETEEMLKVG |
Rabbit Polyclonal Anti-MUL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C1orf166 antibody: synthetic peptide directed towards the middle region of human C1orf166. Synthetic peptide located within the following region: GMQYYLSSQDFDSLLQRQESSVRLWKVLALVFGFATCATLFFILRKQYLQ |
USD 1,290.00
2 Weeks
MUL1 CRISPRa kit - CRISPR gene activation of human mitochondrial E3 ubiquitin protein ligase 1
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Mul1 CRISPRa kit - CRISPR gene activation of mouse mitochondrial ubiquitin ligase activator of NFKB 1
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene MUL1
| Application | Plasmid of exact quantity for transcript copy number calculation |
USD 120.00
5 Days
qSTAR qPCR primer pairs against Homo sapiens gene MUL1
USD 121.00
2 Weeks
MUL1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Mul1 (untagged) - Mouse mitochondrial ubiquitin ligase activator of NFKB 1 (Mul1), nuclear gene encoding mitochondrial protein, (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
qSTAR qPCR primer pairs against Mus musculus gene Mul1
Mul1 (untagged ORF) - Rat mitochondrial ubiquitin ligase activator of NFKB 1 (Mul1), nuclear gene encoding mitochondrial protein, (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
3`UTR clone of mitochondrial E3 ubiquitin ligase 1 (MUL1) nuclear gene encoding mitochondrial protein for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
Mul1 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
MUL1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-352 of human MUL1 (NP_078820.2). |
| Modifications | Unmodified |
Transient overexpression of MUL1 (NM_024544) in HEK293T cells paraffin embedded controls for ICC/IHC staining
USD 1,395.00
3 Weeks
MUL1 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Mul1 - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Active filters
Target Symbol
- MUL1