Products

View as table Download

Rabbit Polyclonal Anti-PRUNE Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PRUNE antibody is: synthetic peptide directed towards the C-terminal region of Human PRUNE. Synthetic peptide located within the following region: NSLISGLSQDEEDPPLPPTPMNSLVDECPLDQGLPKLSAEAVFEKCSQIS

PRUNE (PRUNE1) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 367-397aa) of human PRUNE

PRUNE1 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human PRUNE

PRUNE1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human PRUNE

PRUNE1 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human PRUNE1

PRUNE1 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human PRUNE1