Germany
Japan
United Kingdom
China
PRUNE (Myc-DDK-tagged)-Human prune homolog (Drosophila) (PRUNE)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Prune (Myc-DDK-tagged) - Mouse prune homolog (Drosophila) (Prune)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Prune (Myc-DDK-tagged) - Mouse prune homolog (Drosophila) (Prune)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Prune (mGFP-tagged) - Mouse prune homolog (Drosophila) (Prune)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human prune homolog (Drosophila) (PRUNE), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human prune homolog (Drosophila) (PRUNE), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Prune (Myc-DDK-tagged ORF) - Rat prune homolog (Drosophila) (Prune), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Prune (Myc-DDK-tagged ORF) - Rat prune homolog (Drosophila) (Prune), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 1,030.00
12 Weeks
Lenti ORF particles, Prune (Myc-DDK-tagged ORF) - Rat prune homolog (Drosophila) (Prune), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Prune (mGFP-tagged ORF) - Rat prune homolog (Drosophila) (Prune), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 1,150.00
12 Weeks
Lenti ORF particles, Prune (GFP-tagged ORF) - Rat prune homolog (Drosophila) (Prune), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Rabbit Polyclonal Anti-PRUNE Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PRUNE antibody is: synthetic peptide directed towards the C-terminal region of Human PRUNE. Synthetic peptide located within the following region: NSLISGLSQDEEDPPLPPTPMNSLVDECPLDQGLPKLSAEAVFEKCSQIS |
PRUNE (untagged)-Human prune homolog (Drosophila) (PRUNE)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human prune homolog (Drosophila) (PRUNE), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human prune homolog (Drosophila) (PRUNE), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
PRUNE1 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
PRUNE - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Prune1 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Prune - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
qSTAR qPCR primer pairs against Homo sapiens gene PRUNE
Transient overexpression lysate of prune homolog (Drosophila) (PRUNE)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
qSTAR qPCR primer pairs against Mus musculus gene Prune
PRUNE1 CRISPRa kit - CRISPR gene activation of human prune exopolyphosphatase 1
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene PRUNE
| Application | Plasmid of exact quantity for transcript copy number calculation |
PRUNE HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
qPCR primer pairs and template standards against Mus musculus gene Prune
| Application | Plasmid of exact quantity for transcript copy number calculation |
PRUNE (GFP-tagged) - Human prune exopolyphosphatase (PRUNE), transcript variant 4
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PRUNE (GFP-tagged) - Human prune exopolyphosphatase (PRUNE), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PRUNE (GFP-tagged) - Human prune exopolyphosphatase (PRUNE), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Prune (untagged ORF) - Rat prune homolog (Drosophila) (Prune), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
PRUNE (untagged) - Human prune exopolyphosphatase (PRUNE), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
PRUNE (untagged) - Human prune exopolyphosphatase (PRUNE), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
PRUNE (untagged) - Human prune exopolyphosphatase (PRUNE), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
PRUNE1 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human PRUNE |
PRUNE1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human PRUNE |
PRUNE1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human PRUNE1 |
Transient overexpression of PRUNE1 (NM_021222) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PRUNE1 (NM_001303243) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PRUNE1 (NM_001303229) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PRUNE1 (NM_001303242) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Prune - Rat, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Prune - Rat shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
PRUNE1 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
Prune1 - Mouse, 4 unique 29mer shRNA constructs in retroviral untagged vectorr
| Format | Retroviral plasmids |
| Vector | pRS |
Prune - Rat, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
Transient overexpression of PRUNE1 (NM_021222) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PRUNE1 (NM_021222) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- PRUNE1