Products

View as table Download

Nogo A (RTN4) (Isoform 1) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide corresponding to the C-terminal of human Nogo-A

Rabbit Polyclonal NogoA Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen NogoA antibody was raised against a 23 amino acid peptide from near the amino terminus of human NogoA.

Anti-RTN4 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1179-1194 amino acids of Human reticulon 4

Rabbit Polyclonal NogoA Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen NogoA antibody was raised against a 19 amino acid peptide from near the center of human NogoA.

Nogo A (RTN4) (501-515) goat polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Human, Monkey
Immunogen Synthetic peptide from an internal region of human RTN4 / Nogo (NP_065393.1; NP_997404.1)

Rabbit Polyclonal Nogo Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic sequence corresponding to amino acids 14-30 (DSPPRPQPAFKYQFVRE) of human Nogo A was used as the immunogen for this antibody.

Rabbit Polyclonal Anti-RTN4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RTN4 antibody: synthetic peptide directed towards the middle region of human RTN4. Synthetic peptide located within the following region: FRIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNCTI

Rabbit Polyclonal Anti-RTN4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RTN4 antibody: synthetic peptide directed towards the middle region of human RTN4. Synthetic peptide located within the following region: RAYLESEVAISEELVQKYSNSALGHVNCTIKELRRLFLVDDLVDSLKFAV

Anti-RTN4 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1179-1192 amino acids of Human reticulon 4

RTN4 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human RTN4.
Modifications Unmodified