Products

View as table Download

Rabbit polyclonal anti-TNF12 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Immunogen The antiserum was produced against synthesized peptide derived from internal of human TNF12.

Rabbit Polyclonal TWEAK Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen TWEAK antibody was raised against recombinant human TWEAK protein.

TNFSF12-TNFSF13 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 51-100 of Human TWEAK.

Biotinylated Anti-Human TWEAK Goat Polyclonal Antibody

Applications ELISA
Reactivities Human
Immunogen E.coli derived Recombinant Human TWEAK

Anti-Human TWEAK Goat Polyclonal Antibody

Applications ELISA
Reactivities Human
Immunogen E.coli derived Recombinant Human TWEAK

Rabbit Polyclonal Anti-TNFSF12 Antibody

Applications WB
Reactivities Human
Immunogen The immunogen for anti-TNFSF12 antibody: synthetic peptide directed towards the N terminal of human TNFSF12. Synthetic peptide located within the following region: QEELVAEEDQDPSELNPQTEESQDPAPFLNRLVRPRRSAPKGRKTRARRA

Rabbit Polyclonal Anti-TNFSF12 Antibody

Applications WB
Reactivities Human
Immunogen The immunogen for anti-TNFSF12 antibody: synthetic peptide directed towards the N terminal of human TNFSF12. Synthetic peptide located within the following region: LGLLLAVVSLGSRASLSAQEPAQEELVAEEDQDPSELNPQTEESQDPAPF

TNFSF12 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human TNFSF12
Modifications Unmodified