Products

View as table Download

Rabbit polyclonal Retinoid X Receptor gamma antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Retinoid X Receptor ? antibody.

Rabbit Polyclonal Anti-RXRA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RXRA Antibody: synthetic peptide directed towards the N terminal of human RXRA. Synthetic peptide located within the following region: DTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPI

Rabbit polyclonal PPAR a (Ab-21) antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human PPAR a around the phosphorylation site of serine 21 (L-E-SP-P-L).

Rabbit Polyclonal Anti-RXRG Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-RXRG antibody: synthetic peptide directed towards the C terminal of human RXRG. Synthetic peptide located within the following region: LEAYTKQKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDT

Rabbit Polyclonal Anti-RXRB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RXRB antibody: synthetic peptide directed towards the C terminal of human RXRB. Synthetic peptide located within the following region: AKGLSNPSEVEVLREKVYASLETYCKQKYPEQQGRFAKLLLRLPALRSIG

Goat Polyclonal Antibody against RXRA

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence CQVNSSLTSPTGRGSM, from the internal region of the protein sequence according to NP_002948.1.

Anti-PPARA Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1-18 amino acids of human peroxisome proliferator-activated receptor alpha

Rabbit Polyclonal Anti-RXRA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RXRA Antibody: synthetic peptide directed towards the C terminal of human RXRA. Synthetic peptide located within the following region: MDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQ

Rabbit Polyclonal Anti-RXRB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RXRB antibody: synthetic peptide directed towards the N terminal of human RXRB. Synthetic peptide located within the following region: MHCGVASRWRRRRPWLDPAAAAAAAVAGGEQQTPEPEPGEAGRDGMGDSG

Goat Polyclonal Antibody against RXR beta

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence CRDGMGDSGRDSRSP, from the internal region of the protein sequence according to NP_068811.

Goat Polyclonal Antibody against RXR gamma

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence RQRSRERAESEAEC, from the internal region of the protein sequence according to NP_008848.

Rabbit polyclonal antibody to Retinoid X Receptor beta (retinoid X receptor, beta)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 20 and 113 of Retinoid X Receptor beta (Uniprot ID#P28702)

Rabbit anti-PPARA polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide derived from Human PPAR alpha.

Rabbit Polyclonal Anti-RXRB Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-RXRB antibody: synthetic peptide directed towards the N terminal of human RXRB. Synthetic peptide located within the following region: GDSGRDSRSPDSSSPNPLPQGVPPPSPPGPPLPPSTAPSLGGSGAPPPPP

Rabbit Polyclonal Anti-RXRA Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-RXRA antibody: synthetic peptide directed towards the N terminal of human RXRA. Synthetic peptide located within the following region: GPGIGSPGQLHSPISTLSSPINGMGPPFSVISSPMGPHSMSVPTTPTLGF

Rabbit Polyclonal Anti-PPARA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPARA antibody: synthetic peptide directed towards the middle region of human PPARA. Synthetic peptide located within the following region: SEKAKLKAEILTCEHDIEDSETADLKSLAKRIYEAYLKNFNMNKVKARVI

Rabbit Polyclonal Anti-RXRB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RXRB antibody: synthetic peptide directed towards the N terminal of human RXRB. Synthetic peptide located within the following region: PGFSGPVSSPQINSTVSLPGGGSGPPEDVKPPVLGVRGLHCPPPPGGPGA

Rabbit Polyclonal Anti-RXRG Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RXRG antibody: synthetic peptide directed towards the N terminal of human RXRG. Synthetic peptide located within the following region: NVVNSVSSSEDIKPLPGLPGIGNMNYPSTSPGSLVKHICAICGDRSSGKH

Rabbit Polyclonal Anti-RXRA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RXRA antibody: synthetic peptide directed towards the N terminal of human RXRA. Synthetic peptide located within the following region: DTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPI

Rabbit Polyclonal Anti-RXRA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RXRA antibody: synthetic peptide directed towards the C terminal of human RXRA. Synthetic peptide located within the following region: MDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQ

Rabbit Polyclonal Anti-RXRG Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RXRG antibody: synthetic peptide directed towards the N terminal of human RXRG. Synthetic peptide located within the following region: GSPYRVITSAMGPPSGALAAPPGINLVAPPSSQLNVVNSVSSSEDIKPLP

Rabbit anti PPARa Polyclonal Antibody

Reactivities Human
Conjugation Unconjugated

Rabbit anti PPARg Polyclonal Antibody

Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PPARA mouse monoclonal antibody, clone OTI2D10 (formerly 2D10)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PPARA mouse monoclonal antibody, clone OTI3G3 (formerly 3G3)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PPARA mouse monoclonal antibody, clone OTI1E8 (formerly 1E8)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PPARA mouse monoclonal antibody, clone OTI1E11 (formerly 1E11)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PPARA mouse monoclonal antibody, clone OTI2F3 (formerly 2F3)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PPARA mouse monoclonal antibody, clone OTI2E7 (formerly 2E7)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PPARA mouse monoclonal antibody, clone OTI2G6 (formerly 2G6)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-PPARA rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1-18 amino acids of Human peroxisome proliferator-activated receptor alpha

PPARA (PPAR alpha) mouse monoclonal antibody, clone OTI2D10 (formerly 2D10)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PPARA (PPAR alpha) mouse monoclonal antibody, clone OTI2D10 (formerly 2D10)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PPARA (PPAR alpha) mouse monoclonal antibody, clone OTI3G3 (formerly 3G3)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PPARA (PPAR alpha) mouse monoclonal antibody, clone OTI3G3 (formerly 3G3)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PPARA (PPAR alpha) mouse monoclonal antibody, clone OTI1E8 (formerly 1E8)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PPARA (PPAR alpha) mouse monoclonal antibody, clone OTI1E8 (formerly 1E8)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PPARA (PPAR alpha) mouse monoclonal antibody, clone OTI1E11 (formerly 1E11)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PPARA (PPAR alpha) mouse monoclonal antibody, clone OTI1E11 (formerly 1E11)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PPARA (PPAR alpha) mouse monoclonal antibody, clone OTI2F3 (formerly 2F3)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PPARA (PPAR alpha) mouse monoclonal antibody, clone OTI2F3 (formerly 2F3)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PPARA (PPAR alpha) mouse monoclonal antibody, clone OTI2E7 (formerly 2E7)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PPARA (PPAR alpha) mouse monoclonal antibody, clone OTI2E7 (formerly 2E7)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PPARA (PPAR alpha) mouse monoclonal antibody, clone OTI2G6 (formerly 2G6)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PPARA (PPAR alpha) mouse monoclonal antibody, clone OTI2G6 (formerly 2G6)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated