Germany
Japan
United Kingdom
China
Products
View as table Download
Rabbit Polyclonal Anti-NFKBIB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human NFKBIB |
Rabbit polyclonal PAK1 (Ab-204) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PAK1 around the phosphorylation site of serine 204 (T-R-SP-V-I). |
Rabbit polyclonal PAK1 (Phospho-Ser199) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PAK1/2 around the phosphorylation site of serine 199 (T-K-SP-V-Y). |
| Modifications | Phospho-specific |
Rabbit polyclonal PAK1 (Phospho-Ser204) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PAK1 around the phosphorylation site of serine 204 (T-R-SP-V-I). |
| Modifications | Phospho-specific |
Rabbit polyclonal PAK1/2 (Ab-199) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PAK1/2 around the phosphorylation site of serine 199 (T-K-SP-V-Y). |
PAK1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PAK1 |
Rabbit Polyclonal Anti-Phospho-Paxillin(Ser178) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Phospho-Paxillin(Ser178) Antibody: A synthesized peptide derived from human Paxillin around the phosphorylation site of Sersine 178 |
| Modifications | Phospho-specific |
Rabbit polyclonal IkB-beta (Ser23) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human: Ser23, Mouse: Ser23, Rat: Ser23 |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human I?B-β around the phosphorylation site of serine 23. |
| Modifications | Phospho-specific |
Anti-PAK1 (Phospho-Thr212) Rabbit Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of threonine 212 (P-V-T(p)-P-T) derived from Human PAK1. |
| Modifications | Phospho-specific |
Rabbit Polyclonal IkappaB-beta Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human IkappaB-beta |
Rabbit Polyclonal I kappaB- beta (Thr19) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human I kappaB- beta around the phosphorylation site of Threonine 19 |
| Modifications | Phospho-specific |
Rabbit Polyclonal PAK1 (Thr212) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PAK1 around the phosphorylation site of Threonine 212 |
| Modifications | Phospho-specific |
Rabbit polyclonal Paxillin (Phospho-Ser178) antibody
| Applications | WB |
| Reactivities | H:S178, M:S178, R:S207 |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Paxillin around the phosphorylation site of Ser178. |
| Modifications | Phospho-specific |
Rabbit polyclonal PAK1/2/3 (Ab-423/402/421) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PAK1/2/3 around the phosphorylation site of threonine 423/402/421 (R-S-TP-M-V). |
Rabbit polyclonal Paxillin (Ab-272) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Paxillin around the phosphorylation site of serine 272 (M-A-SP-L-S). |
Rabbit polyclonal PAK1/2/3 (Phospho-Thr423/402/421) antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PAK1/2/3 around the phosphorylation site of threonine 423/402/421 (R-S-TP-M-V). |
| Modifications | Phospho-specific |
Rabbit polyclonal Paxillin (Phospho-Ser272) antibody
| Applications | WB |
| Reactivities | H:S272, M:S272, R:S301 |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Paxillin around the phosphorylation site of Ser272. |
| Modifications | Phospho-specific |
Rabbit Polyclonal Phospho-Paxillin (Tyr31) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Paxillin around the phosphorylation site of Tyrosine 31 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Paxillin Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Paxillin |
Rabbit Polyclonal Paxillin Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Paxillin |
Goat Polyclonal Antibody against PAK1
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-NTEKQKKKPKMSDE, from the internal region of the protein sequence according to NP_002567.3. |
Anti-PXN (Phospho-Tyr118) Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of tyrosine 118 (H-V-Y(p)-S-F) derived from Human Paxillin. |
| Modifications | Phospho-specific |
Rabbit Polyclonal I kappaB- beta (Ser23) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human I kappaB- beta around the phosphorylation site of Serine 23 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Phospho-Paxillin (Tyr118) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Paxillin around the phosphorylation site of Tyrosine 118 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-NFKBIB Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-NFKBIB Antibody: synthetic peptide directed towards the C terminal of human NFKBIB. Synthetic peptide located within the following region: MLRPNPILARLLRAHGAPEPEGEDEKSGPCSSSSDSDSGDEGDEYDDIVV |
Rabbit anti-PXN (Paxillin, Phospho-Tyr31) polyclonal antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanPaxillin around the phosphorylation site of tyrosine 31 (T-P-YP-S-Y). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-IKB beta antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | IkBb peptide corresponding to a region near the C-terminus of the human protein conjugated to Keyhole Limpet Hemocyanin (KLH). |
Anti-PXN (Phospho-Tyr31) Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of tyrosine 31 (T-P-Y(p)-S-Y) derived from Human Paxillin. |
| Modifications | Phospho-specific |
Anti-NFKBIB (Phospho-Ser23) Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of serine 23 (L-G-S(p)-L-G) derived from Human I?B-β. |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-NFKBIB Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-NFKBIB Antibody: synthetic peptide directed towards the middle region of human NFKBIB. Synthetic peptide located within the following region: PILARLLRAHGAPEPEGEDEKSGPCSSSSDSDSGDEGDEYDDIVVHSSRS |
Rabbit Polyclonal Anti-NFKBIB Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-NFKBIB Antibody: synthetic peptide directed towards the N terminal of human NFKBIB. Synthetic peptide located within the following region: LVFGYVTEDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTAL |
Rabbit Polyclonal Anti-NFKBIB Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-NFKBIB Antibody: synthetic peptide directed towards the N terminal of human NFKBIB. Synthetic peptide located within the following region: DLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVCA |
Carrier-free (BSA/glycerol-free) PXN mouse monoclonal antibody,clone OTI2B8
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PXN mouse monoclonal antibody,clone OTI8C12
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PXN mouse monoclonal antibody,clone OTI6B7
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PXN mouse monoclonal antibody,clone OTI6G9
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Anti-PXN Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 1-15 amino acids of Human paxillin |
Anti-PAK1 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 225-238 amino acids of Human p21 protein (Cdc42/Rac)-activated kinase |
PXN mouse monoclonal antibody,clone OTI2B8
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
PXN mouse monoclonal antibody,clone OTI2B8
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Conjugates
- Unconjugated
Families
- Stem cell - Pluripotency
Pathways
- Chemokine signaling pathway