Products

View as table Download

Rabbit polyclonal antibody to EML1 (echinoderm microtubule associated protein like 1)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 753 and 815 of EML1 (Uniprot ID#O00423)

Rabbit Polyclonal antibody to FBXO43 (F-box protein 43)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 646 and 708 of FBXO43 (Uniprot ID#Q4G163)

Rabbit Polyclonal antibody to GALNT7 (UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 7 (GalNAc-T7))

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 24 and 515 of GALNT7 (Uniprot ID#Q86SF2)

Mouse Monoclonal anti-slo1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat, Zebrafish
Conjugation Unconjugated

Rabbit Polyclonal SNX27 Antibody

Applications WB
Reactivities Bovine, Human, Mouse, Rat, Zebrafish
Conjugation Unconjugated
Immunogen Synthetic peptide made to an internal portion of the human protein (within residues 450-500). [Swiss-Prot# Q96L92]

CALCRL / CRLR Rabbit Polyclonal (Cytoplasmic Domain) Antibody

Applications IHC
Reactivities Gibbon, Bovine, Dog, Xenopus, Gorilla, Goat, Hamster, Horse, Human, Monkey, Orang-Utan, Pig, Rabbit, Rat
Conjugation Unconjugated
Immunogen CALCRL / CGRP Receptor antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human CALCRL. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Rat, Goat, Hamster, Panda, Dog, Bovine, Horse, Rabbit, Pig, Opossum, Xenopus (100%); Mouse, Elephant, Bat, Guinea pig, Stickleback, Pufferfish, Zebrafish (94%); Turkey, Chicken (81%).

CLTC / Clathrin Heavy Chain Goat Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bat, Bovine, Chicken, Human, Monkey, Mouse, Rabbit, Rat, Xenopus, Zebrafish, Gorilla, Dog, Pig, Horse, Gibbon
Conjugation Unconjugated
Immunogen CLTC / Clathrin Heavy Chain antibody was raised against synthetic peptide C-ESLRKEEEQATETQ from an internal region (near C-terminus) of human CLTC (NP_004850.1). Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Elephant, Panda, Dog, Bat, Bovine, Horse, Rabbit, Pig, Opossum, Turkey, Chicken, Platypus, Xenopus, Zebrafish (100%); Stickleback (93%); Pufferfish (86%).

UCP2 Goat Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bat, Gibbon, Bovine, Dog, Xenopus, Gorilla, Hamster, Horse, Human, Monkey, Mouse, Orang-Utan, Pig, Rabbit, Rat
Conjugation Unconjugated
Immunogen UCP2 antibody was raised against synthetic peptide C-DSVKQFYTKGSEH from an internal region of human UCP2 (NP_003346.2). Percent identity by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bat, Bovine, Dog, Horse, Rabbit, Pig, Opossum, Xenopus, Stickleback (100%); Smelt, Zebrafish (92%); Trout, Salmon (85%).

SCG10 / STMN2 Goat Polyclonal Antibody

Applications IHC
Reactivities Bovine, Chicken, Dog, Hamster, Horse, Human, Monkey, Mouse, Rabbit, Rat
Conjugation Unconjugated
Immunogen SCG10 / STMN2 antibody was raised against synthetic peptide AKTAMAYKEK-C from the N-terminus of human STMN2 (NP_008960.2). Percent identity by BLAST analysis: Human, Marmoset, Mouse, Rat, Hamster, Elephant, Dog, Bovine, Horse, Rabbit, Turkey, Chicken (100%); Xenopus, Stickleback, Zebrafish (90%); Water flea, Poplar, Arabidopsis (80%).

Rabbit polyclonal SMAD3 phospho S423/phospho S425 antibody

Applications IHC, WB
Reactivities Human, Zebrafish, Rat, Mouse, Swine, Bovine, Chicken
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 417-425 of human SMAD3 protein.

Rabbit polyclonal CAF-1 Antibody (N-term)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CAF-1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 34-61 amino acids from the N-terminal region of human CAF-1.

Rabbit polyclonal METTL2 Antibody (C-term)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This METTL2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 329-359 amino acids from the C-terminal region of human METTL2.

Rabbit polyclonal Mib1/Mindbomb Antibody (N-term)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This Mib1/Mindbomb antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 13-42 amino acids from the N-terminal region of human Mib1/Mindbomb.

Rabbit polyclonal SMAD2 Antibody

Applications FC, IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This SMAD2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 97-125 amino acids from human SMAD2.

Rabbit Polyclonal Anti-PTBP1 Antibody

Applications WB
Reactivities Bovine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish, Dog, Pig, Horse
Conjugation Unconjugated
Immunogen The immunogen for anti-PTBP1 antibody: synthetic peptide directed towards the middle region of human PTBP1. Synthetic peptide located within the following region: KGFKFFQKDRKMALIQMGSVEEAVQALIDLHNHDLGENHHLRVSFSKSTI

Goat Polyclonal Anti-MNSOD (aa119-130) Antibody

Applications WB
Reactivities Human, Mouse, Rat (Expected from sequence similarity: Zebrafish, Dog, Pig, Cow)
Conjugation Unconjugated
Immunogen The immunogen for Anti-MNSOD (aa119-130) Antibody: Peptide with sequence C-EAIKRDFGSFDK, from the internal region of the protein sequence according to NP_000627.2; NP_001019637.1.

CASK mouse monoclonal antibody, clone K56A/50

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat, Xenopus, Zebrafish
Conjugation Unconjugated

Kcnab2 mouse monoclonal antibody, clone K17/70

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat, Zebrafish
Conjugation Unconjugated

CASK mouse monoclonal antibody, clone K56A/50

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat, Xenopus, Zebrafish
Conjugation Unconjugated

Kcnab2 mouse monoclonal antibody, clone K17/70

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat, Zebrafish
Conjugation Unconjugated

USD 320.00

In Stock

Goat Polyclonal Anti-CDH11 Antibody

Applications WB
Reactivities Zebrafish
Conjugation Unconjugated
Immunogen Purified recombinant peptide fused with GST and produced in E. coli.

USD 320.00

In Stock

Goat Polyclonal Anti-CDH11 Antibody

Applications WB
Reactivities Zebrafish
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 752 aa to the C-terminus of CDH11 produced in E. coli.

Rabbit Polyclonal Antibody against FGFR1 (Y653)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This FGFR1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 631-660 amino acids from human FGFR1.

Goat Polyclonal Antibody against TCF2 / VHNF1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QAYDRQKNPSKEER, from the internal region of the protein sequence according to NP_000449.1; NP_006472.1.

Rabbit Polyclonal antibody to DUSP7 (dual specificity phosphatase 7)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 258 and 350 of DUSP7 (Uniprot ID#Q16829)

Rabbit Polyclonal antibody to DLST (dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex))

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 188 and 453 of DLST (Uniprot ID#P36957)

Rabbit polyclonal antibody to RAB6A (RAB6A, member RAS oncogene family)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 208 of RAB6A (Uniprot ID#P20340)

Rabbit polyclonal antibody to UAP1 (UDP-N-acteylglucosamine pyrophosphorylase 1)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein fragment contain a sequence corresponding to a region within amino acids 53 and 473 of UAP1

Rabbit Polyclonal antibody to RPL13A (ribosomal protein L13a)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 203 of RPL13A (Uniprot ID#P40429)

Rabbit Polyclonal antibody to PGD (phosphogluconate dehydrogenase)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 201 of PGD (Uniprot ID#P52209)

Rabbit polyclonal antibody to VPS11 (vacuolar protein sorting 11 homolog (S. cerevisiae))

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 300 and 392 of VPS11 (Uniprot ID#Q9H270)

Rabbit Polyclonal antibody to ARSA (arsA arsenite transporter, ATP-binding, homolog 1 (bacterial))

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 45 and 279 of ASNA1 (Uniprot ID#O43681)

Rabbit polyclonal antibody to CKS-2 (CDC28 protein kinase regulatory subunit 2)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 15 and 79 of CKS2 (Uniprot ID#P33552)

Rabbit Polyclonal antibody to Importin 7 (importin 7)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 976 and 1038 of Importin 7 (Uniprot ID#O95373)

Rabbit Polyclonal antibody to RanBP16 (exportin 7)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 902 and 1087 of RanBP16 (Uniprot ID#Q9UIA9)

Rabbit Polyclonal antibody to GIPC1 (GIPC PDZ domain containing family, member 1)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 273 and 333 of GIPC1

Rabbit polyclonal antibody to DMC1 (DMC1 dosage suppressor of mck1 homolog, meiosis-specific homologous recombination (yeast))

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 206 of DMC1 (Uniprot ID#Q14565)

Rabbit polyclonal antibody to SAP130 (splicing factor 3b, subunit 3, 130kDa)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 1154 and 1217 of SAP130 (Uniprot ID#Q15393)

Rabbit polyclonal antibody to PSMC3 (proteasome (prosome, macropain) 26S subunit, ATPase, 3)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 51 and 361 of PSMC3 (Uniprot ID#P17980)

Rabbit Polyclonal antibody to ARAF (v-raf murine sarcoma 3611 viral oncogene homolog)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 371 and 554 of A-RAF (Uniprot ID#P10398)

Rabbit polyclonal antibody to PSR (jumonji domain containing 6)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 234 of PSR (Uniprot ID#Q6NYC1)

Rabbit Polyclonal antibody to SNX12 (sorting nexin 12)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide contain a sequence corresponding to a region within amino acids 100 and 112 of SNX12

Rabbit Polyclonal antibody to PUF60 (poly-U binding splicing factor 60KDa)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment contain a sequence corresponding to a region within amino acids 346 and 523 of PUF60 (Uniprot ID#Q9UHX1)

Rabbit Polyclonal antibody to VPS35 (vacuolar protein sorting 35 homolog (S. cerevisiae))

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 733 and 796 of VPS35 (Uniprot ID#Q96QK1)

Rabbit polyclonal antibody to PSMB8 (proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctional peptidase 7))

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 52 and 276 of PSMB8 (Uniprot ID#P28062)

Rabbit Polyclonal antibody to DOCK1 (dedicator of cytokinesis 1)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 1802 and 1865 of DOCK1

Rabbit Polyclonal antibody to Histone H2A.Z (H2A histone family, member Z)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 1 and 45 of Histone H2A.Z

Rabbit Polyclonal antibody to PSMC6 (proteasome (prosome, macropain) 26S subunit, ATPase, 6)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 301 of PSMC6 (Uniprot ID#P62333)

Rabbit Polyclonal antibody to SUCLA2 (succinate-CoA ligase, ADP-forming, beta subunit)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 138 and 416 of SUCLA2 (Uniprot ID#Q9P2R7)

Rabbit Polyclonal antibody to Transmembrane protein 147 (transmembrane protein 147)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 37 and 131 of Transmembrane protein 147 (Uniprot ID#Q9BVK8)