lL-10 Rat monoclonal antibody, ELISA and Luminex validated, clone OTI9D7
Applications | ELISA, LMNX |
Reactivities | Human |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700017 |
lL-10 Rat monoclonal antibody, ELISA and Luminex validated, clone OTI9D7
Applications | ELISA, LMNX |
Reactivities | Human |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700017 |
DiMethyl-Histone H3-K4 Rabbit Polyclonal Antibody
Applications | ChIP, ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat, Other (Wide Range) |
Conjugation | Unconjugated |
Immunogen | A synthetic methylated peptide corresponding to residues surrounding K4 of human histone H3 |
DiMethyl-Histone H3-K36 Rabbit Polyclonal Antibody
Applications | ChIP, ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat, Other (Wide Range) |
Conjugation | Unconjugated |
Immunogen | A synthetic methylated peptide corresponding to residues surrounding K36 of human histone H3 |
Symmetric DiMethyl-Histone H3-R8 Rabbit Polyclonal Antibody
Applications | ChIP, ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat, Other (Wide Range) |
Conjugation | Unconjugated |
Immunogen | A synthetic methylated peptide corresponding to residues surrounding R8 of human histone H3 |
Rabbit Polyclonal H3K9/14ac Antibody
Applications | Dot, ELISA, IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-H3K9/14ac antibody: histone H3 acetylated at lysines 9 and 14 (H3K9/14ac), using a KLH-conjugated synthetic peptide. |
MonoMethyl-Histone H3-K27 Rabbit Polyclonal Antibody
Applications | ChIP, Dot, ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Other (Wide Range) |
Conjugation | Unconjugated |
Immunogen | A synthetic methylated peptide corresponding to residues surrounding K27 of human histone H3 |
TriMethyl-Histone H3-K79 Rabbit Polyclonal Antibody
Applications | ChIP, Dot, ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Other (Wide Range) |
Conjugation | Unconjugated |
Immunogen | A synthetic methylated peptide corresponding to residues surrounding K79 of human histone H3 |
Rabbit Polyclonal H3K9me2 Antibody
Applications | Dot, ELISA, IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-H3K9me2 antibody: the region of histone H3 containing the dimethylated lysine 9 (H3K9me2), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal H3K27me3S28p Antibody
Applications | Dot, ELISA, IF, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-H3K27me3S28p antibody: histone H3 containing the trimethylated lysine 27 and the phosphorylated serine 28 (H3K27me3S28p), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal H3S10p Antibody
Applications | Dot, ELISA, IF, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-H3S10p antibody: histone H3 containing the phosphorylated serine 10 (H3S10p), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal H3K27me3 Antibody
Applications | Dot, ELISA, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-H3K27me3 antibody: against histone H3, trimethylated at lysine 27 (H3K27me3), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal H3K36me2 Antibody
Applications | Dot, ELISA, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-H3K36me2 antibody: histone H3 containing the dimethylated lysine 36 (H3K36me2), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal H3K9ac Antibody
Applications | Dot, ELISA, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-H3K9ac antibody: histone H3, acetylated at lysine 9 (H3K9ac), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal H3K4me2 Antibody
Applications | Dot, ELISA, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-H3K4me2 antibody: histone H3 containing the dimethylated lysine 4 (H3K4me2), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal H3K79me2 Antibody
Applications | Dot, ELISA, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-H3K79me2 antibody: the region of histone H3 containing the dimethylated lysine 79 (H3K79me2), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal H3K18ac Antibody
Applications | Dot, ELISA, IF, WB |
Reactivities | Human, Mouse, Broad |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-H3K18ac antibody: the region of histone H3 containing the acetylated lysine 18 (H3K18ac), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal H3R17me2(asym)K18ac Antibody
Applications | Dot, ELISA, IF, WB |
Reactivities | Human, Mouse, Broad |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-H3R17me2(asym)K18ac antibody: the region of histone H3 containing the asymmetrically dimethylated R17 and the acetylated lysine 18 (H3R17me2(asym)K18ac), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal H4K5,8,12ac Antibody
Applications | Dot, ELISA, IF, WB |
Reactivities | Human, Mouse, Broad |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-H4K5,8,12ac antibody: the region of histone H4 containing the acetylated lysines 5, 8 and 12 (H4K5,8,12ac), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal H4K20me3 Antibody
Applications | Dot, ELISA, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-H4K20me3 antibody: the region of histone H4 containing the trimethylated lysine 20 (H4K20me3), using a KLH-conjugated synthetic peptide. |
Rabbit anti-Histone H4K20me2 Polyclonal Antibody
Applications | ChIP, ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat, Other (Wide Range) |
Conjugation | Unconjugated |
Immunogen | A synthetic methylated peptide corresponding to residues surrounding K20 of human histone H4 |
Rabbit Polyclonal H3K9me1 Antibody
Applications | Dot, ELISA, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-H3K9me1 antibody: histone H3 containing the monomethylated lysine 9 (H3K9me1), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal H3K9acS10p Antibody
Applications | Dot, ELISA, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-H3K9acS10p antibody: histone H3 containing the acetylated lysine 9 and the phosphorylated serine 10 (H3K9acS10p), using a KLH-conjugated synthetic peptide |
Rabbit Polyclonal H3K9me3S10p Antibody
Applications | Dot, ELISA, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-H3K9me3S10p antibody: histone H3 containing trimethylated lysine 9 and the phosphorylated serine 10 (H3K9me3S10p), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal H3K4me1 Antibody
Applications | Dot, ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-H3K4me1 antibody: histone H3 containing the monomethylated lysine 4 (H3K4me1), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal H3K27me1 Antibody
Applications | Dot, ELISA, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-H3K27me1 antibody: histone H3 containing the monomethylated lysine 27 (H3K27me1), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal H3K27me2 Antibody
Applications | Dot, ELISA, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-H3K27me2 antibody: the histone H3, dimethylated at lysine 27 (H3K27me2), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal H3K9me3 Antibody
Applications | Dot, ELISA, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-H3K9me3 antibody: the region of histone H3 containing the trimethylated lysine 9 (H3K9me3), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal H3K36me1 Antibody
Applications | Dot, ELISA, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-H3K36me1 antibody: histone H3 containing the monomethylated lysine 36 (H3K36me1), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal H3S10p Antibody
Applications | Dot, ELISA, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-H3S10p antibody: histone H3 containing the phosphorylated serine 10 (H3S10p), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal Anti-IFNG Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human IFNG |
Rabbit Polyclonal H2A.Zac Antibody
Applications | Dot, ELISA, IF |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-H2A.Zac antibody: histone H2A.Z acetylated at lysines 5, 7 and 11, using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal H2BK12ac Antibody
Applications | Dot, ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-H2BK12ac antibody: the region of histone H2B containing the acetylated lysine 12 (H2BK12ac), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal H2BK15ac Antibody
Applications | Dot, ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-H2BK15ac antibody: the region of histone H2B containing the acetylated lysine 15 (H2BK15ac), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal H3K36me3 Antibody
Applications | Dot, ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-H3K36me3 antibody: histone H3 containing the trimethylated lysine 36 (H3K36me3), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal H3K4me3 Antibody
Applications | Dot, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-H3K4me3 antibody: the region of histone H3 containing the trimethylated lysine 4 (H3K4me3), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal H3K36me3 Antibody
Applications | Dot, ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-H3K36me3 antibody: histone H3, trimethylated at lysine 36 (H3K36me3), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal H3K79me3 Antibody
Applications | Dot, ELISA, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-H3K79me3 antibody: histone H3 containing the trimethylated lysine 79 (H3K79me3), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal H3K79me1 Antibody
Applications | Dot, ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-H3K79me1 antibody: histone H3 containing the monomethylated lysine 79 (H3K79me1), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal H2AK5ac Antibody
Applications | Dot, ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-H2AK5ac antibody: the region of histone H2A containing the acetylated lysine 5 (H2AK5ac), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal H4K5,8,12,16ac Antibody
Applications | Dot, ELISA, IF |
Reactivities | Human, Mouse, Broad |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-H4K5,8,12,16ac antibody: the region of histone H4 containing the acetylated lysines 5, 8, 12 and 16 (H4K5,8,12,16ac), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal H4K5ac Antibody
Applications | Dot, ELISA, WB |
Reactivities | Human, Mouse, Broad |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-H4K5ac antibody: the region of histone H4 containing the acetylated lysine 5 (H4K5ac), using a KLH-conjugated synthetic peptide. |
TNF-A Capture mouse monoclonal antibody, ELISA and Luminex validated, clone MAb1
Applications | ELISA, LMNX |
Reactivities | Human |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700026 |
Rabbit Polyclonal Anti-ACTN1 Antibody - N-terminal region
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ACTN1 antibody: synthetic peptide directed towards the N terminal of human ACTN1. Synthetic peptide located within the following region: DHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQ |
Rabbit Polyclonal H3K4me2 Antibody
Applications | Dot, ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-H3K4me2 antibody: histone H3 containing the dimethylated lysine 4 (H3K4me2), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal H3K4me1 Antibody
Applications | Dot, ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-H3K4me1 antibody: histone H3 containing the monomethylated lysine 4 (H3K4me1), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal H4K8ac Antibody
Applications | Dot, ELISA, IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-H4K8ac antibody: the region of histone H4 containing the acetylated lysine 8 (H4K8ac), using a KLH-conjugated synthetic peptide. |
Rabbit Anti-NMDA NR2B Subunit Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein from the C-terminal region of the NR2B subunit |
Rabbit anti-Histone H3K9me3 Polyclonal Antibody
Applications | ChIP, Dot, ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Other (Wide Range) |
Conjugation | Unconjugated |
Immunogen | A synthetic methylated peptide corresponding to residues surrounding K9 of human histone H3 |
Rabbit Polyclonal H3K4me3 Antibody
Applications | Dot, ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-H3K4me3 antibody: the region of histone H3 containing the trimethylated lysine 4 (H3K4me3), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal H3K79me2 Antibody
Applications | Dot, ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-H3K79me2 antibody: histone H3 containing the dimethylated lysine 79 (H3K79me2), using a KLH-conjugated synthetic peptide. |