Products

View as table Download

Rabbit anti-CLCN1 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CLCN1

Rabbit Polyclonal Anti-Clcn1 Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Clcn1 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: SSIFQRLLHCLLGKAHSTKKKITQDSTDLVDNMSPEEIEAWEREQLSQPV

Rabbit Polyclonal Anti-CLC-1

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen Peptide CVHRLGRVLRRKLGED, corresponding to amino acid residues 102-117 of rat CLC-1. Cytoplasmic, N-terminal part.