FKBP5 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human FKBP5 |
FKBP5 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human FKBP5 |
Rabbit Polyclonal FKBP51 Antibody
Applications | ELISA, WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FKBP51 antibody: mouse FKBP51 (FK506 Binding Protein 51), using two KLH-conjugated synthetic peptides containing an amino acid sequence from the central part of the protein |
Mouse monoclonal FKBP51 Antibody
Applications | IF, WB |
Reactivities | Canine, Hamster, Human, Mouse, Rabbit, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-FKBP5 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FKBP5 antibody: synthetic peptide directed towards the C terminal of human FKBP5. Synthetic peptide located within the following region: CYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFE |
Rabbit Polyclonal Anti-FKBP5 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FKBP5 antibody is: synthetic peptide directed towards the middle region of Human FKBP5. Synthetic peptide located within the following region: KMQREEQCILYLGPRYGFGEAGKPKFGIEPNAELIYEVTLKSFEKAKESW |
Carrier-free (BSA/glycerol-free) FKBP5 mouse monoclonal antibody, clone OTI3E9 (formerly 3E9)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
FKBP5 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human FKBP5 |
FKBP5 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human FKBP5 |
FKBP5 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human FKBP5 |
FKBP51/FKBP5 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 308-457 of human FKBP51/FKBP51/FKBP51/FKBP5 (NP_001139247.1). |
Modifications | Unmodified |
FKBP51 Rabbit polyclonal Antibody
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | A synthesized peptide derived from human FKBP51 |
Anti-FKBP5 (FKBP51) mouse monoclonal antibody, clone OTI3E9 (formerly 3E9)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: "KO15".
Anti-FKBP5 (FKBP51) mouse monoclonal antibody, clone OTI3E9 (formerly 3E9)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |