Products

View as table Download

Rabbit Polyclonal Anti-INHBA Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human INHBA

Rabbit Polyclonal antibody to Inhibin beta A (inhibin, beta A)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 362 and 426 of Inhibin beta A

Rabbit anti-INHBA Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human INHBA

Rabbit Polyclonal Anti-INHBA Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-INHBA antibody: synthetic peptide directed towards the N terminal of human INHBA. Synthetic peptide located within the following region: CPSCALAALPKDVPNSQPEMVEAVKKHILNMLHLKKRPDVTQPVPKAALL

Anti-INHBA Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 375-390 amino acids of Human Inhibin beta A chain

INHBA rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human INHBA